A target DNA sequence encoding to the 700-1216aa of human probable global transcription activator SNF2L2 (SMARCA2) was fused with an N-terminal 6xHis-SUMO-tag and then expressed in E.coli. The resulting protein is the partial-length recombinant SMARCA2 protein. Its purity is over 90% measured by SDS-PAGE. This SMARCA2 protein migrated to a 90 kDa molecular mass band on the gel. The in-stock protein allows it to reach your lab bench faster. This recombinant SMARCA2 protein may be applied to generate specific antibodies and in the studies of neuroscience.
SMARCA2 is frequently downregulated in tumors. Tumors with high SMARCA2 levels are mostly associated with a good prognosis. The expression of SMARCA2 is negatively regulated by mitogenic stimulation and Ras and ERK signaling, and restoration of SMARCA2 concentration results in reversion of the transformed phenotype. Studies show that SMARCA2 is required for cell cycle arrest during myoblast differentiation.
I am interested in the SMARCA2 Recombinant Protein (CSB-EP021799HU), but have a few questions first:
1.What is the SUMO tag’s length in CSB-EP021799HU?
2.For product, can these tags be cleaved?
3.The MW of SMARCA2 is ~180 kDa. Why is this protein (CSB-EP021799HU) only 76 kDa?
MAHHHHHHMSDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGGGSEFRT
SYYTVAHAISERVEKQSALLINGTLKHYQLQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWTYEFDKWAPSVVKISYKGTPAMRRSLVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRILLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSALQKILYRHMQAKGILLTDGSEKDKKGKGGAKTLMNTIMQLRKICNHPYMFQHIEESFAEHLGYSNGVINGAELYRASGKFELLDRILPKLRATNHRVLLFCQMTSLMTIMEDYFAFRNFLYLRLDGTTKSEDRAALLKKFNEPGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAF
I have aquestion about item CSB-EP021799HU Recombinant human Probable global transcription activator SNF2L2:
Regarding the purification procedures for this protein – is the protein entirely soluble when expressed in the host cell or are denaturation / renaturation protocols used to prepare this protein?
Would you have this information available that you could share?
SYYTVAHAISERVEKQSALLINGTLKHYQLQGLEWMVSLYNNNLNGILADEMGLGKTIQTIALITYLMEHKRLNGPYLIIVPLSTLSNWTYEFDKWAPSVVKISYKGTPAMRRSLVPQLRSGKFNVLLTTYEYIIKDKHILAKIRWKYMIVDEGHRMKNHHCKLTQVLNTHYVAPRRILLTGTPLQNKLPELWALLNFLLPTIFKSCSTFEQWFNAPFAMTGERVDLNEEETILIIRRLHKVLRPFLLRRLKKEVESQLPEKVEYVIKCDMSALQKILYRHMQAKGILLTDGSEKDKKGKGGAKTLMNTIMQLRKICNHPYMFQHIEESFAEHLGYSNGVINGAELYRASGKFELLDRILPKLRATNHRVLLFCQMTSLMTIMEDYFAFRNFLYLRLDGTTKSEDRAALLKKFNEPGSQYFIFLLSTRAGGLGLNLQAADTVVIFDSDWNPHQDLQAQDRAHRIGQQNEVRVLRLCTVNSVEEKILAAAKYKLNVDQKVIQAGMFDQKSSSHERRAF
Email: support@cusabio.com
Distributors Worldwide