Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Transcription
Alternative Names
Polycomb group RING finger protein 4RING finger protein 51
Species
Homo sapiens (Human)
Expression Region
1-250aa
Target Protein Sequence
MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELE
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
N-terminal GST-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The region for expressing recombinant Human BMI1 contains amino acids 1-250. This BMI1 protein is expected to have a theoretical molecular weight of 56.4 kDa. This protein is generated in a e.coli-based system. The N-terminal GST tag was fused into the coding gene segment of BMI1, making it easier to detect and purify the BMI1 recombinant protein in the later stages of expression and purification.
The human polycomb complex protein BMI1 is a vital component of the polycomb repressive complex 1 (PRC1), crucial for epigenetic gene regulation. Its main function involves the transcriptional repression of target genes, influencing cellular processes like cell cycle regulation and stem cell maintenance. BMI1's role in inhibiting the tumor suppressor p16INK4a highlights its significance in controlling cell proliferation. In research, BMI1 is explored for its implications in cancer, stem cell biology, and developmental processes. Understanding BMI1's functions provides insights into epigenetic mechanisms, with potential applications in cancer therapeutics and regenerative medicine.
