Recombinant Human Podocalyxin (PODXL), partial

Code
MSDS
Size Pls inquire
Source
Conjugate
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
PODXL
Uniprot NO.
Research Area
Cancer
Species
Homo sapiens (Human)
Source
Baculovirus
Expression Region
32-458aa
Target Protein Sequence
QNATQTTTDSSNKTAPTPASSVTIMATDTAQQSTVPTSKANEILASVKATTLGVSSDSPGTTTLAQQVSGPVNTTVARGGGSGNPTTTIESPKSTKSADTTTVATSTATAKPNTTSSQNGAEDTTNSGGKSSHSVTTDLTSTKAEHLTTPHPTSPLSPRQPTSTHPVATPTSSGHDHLMKISSSSSTVAIPGYTFTSPGMTTTLLETVFHHVSQAGLELLTSGDLPTLASQSAGITASSVISQRTQQTSSQMPASSTAPSSQETVQPTSPATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGDQGPPEEAEDRF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
46.2kD
Protein Length
Partial
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Involved in the regulation of both adhesion and cell morphology and cancer progression. Functions as an anti-adhesive molecule that maintains an open filtration pathway between neighboring foot processes in the podocyte by charge repulsion. Acts as a pro-adhesive molecule, enhancing the adherence of cells to immobilized ligands, increasing the rate of migration and cell-cell contacts in an integrin-dependent manner. Induces the formation of apical actin-dependent microvilli. Involved in the formation of a preapical plasma membrane subdomain to set up initial epithelial polarization and the apical lumen formation during renal tubulogenesis. Plays a role in cancer development and aggressiveness by inducing cell migration and invasion through its interaction with the actin-binding protein EZR. Affects EZR-dependent signaling events, leading to increased activities of the MAPK and PI3K pathways in cancer cells.
Gene References into Functions
  1. s-Podxl is independently associated with carotid IMT and might be used as a novel biomarker for cardiovascular disease. PMID:29321582
  2. Results show high podocalyxin expression in prostate cancer and can be used as a tumor marker for disease progression and patients stratification. PMID:30396958
  3. Summary of the structural features of podocalyxin glycoforms from embryonic and induced pluripotent stem cells (review). PMID:28980094
  4. This set of symptoms strikingly mimics previously reported mouse Podxl(-/-) embryos, emphasizing the essential function of PODXL in mammalian kidney development and highlighting this patient as a human PODXL-null model. PMID:29244787
  5. These results indicate that PcMab-47 is useful in detecting podocalyxin of oral cancers for immunohistochemical analysis PMID:28873000
  6. expression of PODXL associates with TAZ downstream gene expression. Suppression of PODXL induces phosphorylation of LATS1 and TAZ, and is accompanied with a decrease in TAZ protein expression. We speculate that changes in actin cytoskeleton may participate in PODXL-mediated TAZ signaling. PMID:28946619
  7. Results show that PODXL performs as a tumor promoter in gastric tumor cells (GC). PODXL is a target gene of miR-509-3-5P; the ectopic expression of miR-509-3-5P in GC cell lines inhibits the colony, motility and invasion abilities via negatively targeting PODXL. PMID:28432273
  8. Podocalyxin as a major pluripotent marker and novel keratan sulfate proteoglycan in human embryonic and induced pluripotent stem cells. PMID:28078490
  9. A novel frameshift mutation in PODXL seems to be the likely cause of ARJP in this family. PMID:26864383
  10. These findings suggest a potential functional link in colorectal cancer between PODXL, EGFR and BRAF. PMID:27160084
  11. PODXL enhances motility and invasiveness through an increase in gelsolin-actin interactions in cell protrusions. PMID:27461278
  12. Results identify an anti-metastatic miRNA, miR-5100, that decreases the metastatic ability of pancreatic cancer partially by suppressing expression of PODXL. PMID:26892887
  13. Results indicate that urinary podocalyxin is not only an early marker but also a treatment target for diabetic nephropathy (DN). PMID:26635084
  14. Obese subjects showed evidence of renal alteration through the detection of a higher number of urinary podocalyxin positive cells. PMID:25905599
  15. Data show that both mucin16 (MUC16) and podocalyxin (PODXL)-E-selectin-mediated interactions are mechanically stronger than like L-selectin interactions at the single-molecule level. PMID:26329844
  16. In gastric cancer, PODXL expression by the polyclonal antibody HPA2110 is an independent marker of poor prognosis. PMID:26674770
  17. PCX promotes cisplatin chemoresistance in osteosarcoma cells through a PI3Kdependent mechanism. PMID:26017117
  18. EZR, CLIC5 and PODXL are overexpressed in hepatocellular carcinoma and may have a role in cell migration and invasiveness PMID:26135398
  19. PODXL up-regulates the expression level of Bmi1 in OTSCC cells. PMID:25915207
  20. podocalyxin to be an independent factor for poor prognosis in PDAC. To our knowledge, this is the first such report of its prognostic value. PMID:26053486
  21. miR-125b was found to be important in arteriosclerosis obliterans by suppressing the expression of PODXL and may serve as a potential therapeutic target for the treatment of arteriosclerosis obliterans. PMID:25738314
  22. We show that podocalyxin plays a key role in the formation of primary tumors and distant tumor metastasis. PMID:25887862
  23. PCLP1 expressed on breast tumor cells may function as an immunomodulatory molecule, which may represent a mechanism to evade the immune response. PMID:26276714
  24. These findings show that overexpression of PODXL enhanced invadopodia formation and tumor metastasis by inducing Rac1/Cdc42/cortactin signaling network. PMID:24970760
  25. overexpression of PODXL may be associated with human oral squamous cell carcinoma aggressiveness PMID:24821609
  26. A variant form of PODXL remains the most likely candidate causing focal and segmental glomerulosclerosis in a family with autosomal dominant inheritance. PMID:24048372
  27. Suggest that analysis of PODXL expression in the primary tumour is sufficient for its use as a prognostic and treatment predictive biomarker in colorectal cancer, also in patients with metastatic disease. PMID:23819542
  28. Urinary Podocalyxin positive-element may be a noninvasive marker for the early stage of Diabetic nephropathy. PMID:24075693
  29. TRA-1-81 is expressed only in the cytoplasm of uterine smooth muscle neoplasms. PMID:24143384
  30. PODXL is expressed in glioblastoma multiforme stem-like cells and is involved in cell proliferation and oncosphere formation. PMID:24146797
  31. Membranous PODXL expression is an independent risk factor for progressive disease and death in patients with urothelial bladder cancer PMID:23652315
  32. The results obtained indicate that integrity of the PODXL ectodomain is essential for enhancing cell adhesion but not migration, while the integrity of the cytoplasmic domain is required for both adhesion and migration. PMID:23396057
  33. PODXL protein expression was analyzed n tissue microarrays with colorectal cancer tumor samples. High PODXL protein expression was significantly associated with unfavourable clinicopathological characteristics in both cohorts. PMID:22769594
  34. PODXL has the potential to be a useful biomarker for identifying good prognosis patients in characteristically poor prognosis breast cancer groups and may impact treatment of women with this disease. PMID:23288345
  35. podocalyxin, a heavily glycosylated type 1 transmembrane protein, is a glycoprotein ligand of recombinant N-terminal domain of the lectin BC2L-C from Burkholderia cenocepacia on human induced pluripotent stem cells and embryonic stem cells. PMID:23526252
  36. Levels of urinary PCX and the number of urinary podocytes are associated with histologic abnormalities in adults with IgA nephropathy. PMID:22700887
  37. Sialofucosylated PODXL is a functional E-and L-selectin ligand expressed by metastatic pancreatic cancer cells. PMID:22814396
  38. Most AML patients had a significant decrease in miR-199b-5p levels with elevated PODXL & DDR1 expressions. Both PODXL & DDR1 are targets of miR-199b-5p. PMID:22374871
  39. podocalyxin's ability to facilitate the formation of non-adhesive membrane domains may contribute to the formation of free-floating high grade serous tumor nodules during the initial steps of transperitoneal metastasis. PMID:22262060
  40. Podocalyxin-like 1 expression is an independent factor of poor prognosis in colorectal carcinoma. PMID:21829192
  41. The urinary mRNA profiles of synaptopodin, podocalyxin, CD2-AP, alpha-actin4, and podocin were found to increase with the progression of diabetic nephropathy. PMID:21655212
  42. This report identifies DNA methylation, miR-199a dysregulation and PODXL as critical factors in tumor malignancy. PMID:21383689
  43. PINCH1 is transcriptional regulator in podocytes that interacts with WT1 and represses podocalyxin expression. PMID:21390327
  44. intact PODXL is released to the extracellular space as a cargo of microvesicles and also as a soluble cleaved fragment of ectodomain PMID:21616097
  45. Data show that podocalyxin overexpression in human embryonic kidney cells up-regulates Rac1 activity, which depends on a complex formed by podocalyxin, ERM-binding phosphoprotein 50, ezrin, and ARHGEF7, a Rac1 activator. PMID:20395446
  46. In pluripotent stem cells and in human cancer disease, podocalyxin may function in part to regulate and maintain the cell surface expression of the glucose-3-transporter. PMID:20599725
  47. podocalyxin has a role in defining the structure of the podocyte basal surface PMID:15226400
  48. Overexpression of the anti-adhesin podocalyxin is associated with breast cancer progression PMID:15289306
  49. PODXL variants are implicated in prostate neoplasm aggressiveness, with gene mapping to chromosome 7q32-q33. PMID:16434482
  50. Transcriptional regulation of Podxl is supported primarily by Sp1 site(s) and that DNA-methylation of the CpG promoter islands contributes to control the tissue specific expression of podxl. PMID:16684343

Show More

Hide All

Subcellular Location
Apical cell membrane. Cell projection, lamellipodium. Cell projection, filopodium. Cell projection, ruffle. Cell projection, microvillus. Membrane raft. Membrane; Single-pass type I membrane protein.
Protein Families
Podocalyxin family
Tissue Specificity
Glomerular epithelium cell (podocyte).
Database Links

HGNC: 9171

UNIGENE: Hs.744213

KEGG: hsa:5420

STRING: 9606.ENSP00000367817

OMIM: 602632

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1