Abbreviation
Recombinant Human PGF protein (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human FLT1(CSB-MP008732HU) protein at 2 μg/mL can bind Human PGF protein. The EC50 is 10.72-15.25 ng/mL.
Research Area
Cardiovascular
Alternative Names
Placenta growth factor; PlGF; PGF; PGFL, PLGF
Species
Homo sapiens (Human)
Expression Region
19-170aa
Target Protein Sequence
LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERRRPKGRGKRRREKQRPTDCHLCGDAVPRR
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein of Isoform PlGF-2
Tag Info
C-terminal hFc1-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human FLT1(CSB-MP008732HU) protein at 2 μg/ml can bind Human PGF protein. The EC50 is 10.72-15.25 ng/mL.
Description
Placenta growth factor (PlGF) plays a critical role in angiogenesis and vascular remodeling, making it a key target in cardiovascular and tumor biology research. This recombinant human PGF, covering the full-length mature sequence of isoform PlGF-2 (aa 19–170) with a C-terminal hFc1 tag, demonstrates strong receptor-binding potency — validated by functional ELISA showing an EC50 of 10.72–15.25 ng/mL against immobilized human FLT1, which supports use in receptor-ligand binding assays, competition ELISAs, and SPR-based interaction studies. Mammalian cell expression preserves native glycosylation patterns essential for proper folding and biological activity, providing a suitable basis for angiogenesis models, endothelial cell proliferation assays, and in vivo tumor angiogenesis studies where post-translational modifications influence signaling outcomes. Purity exceeding 90% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for cell-based functional assays and antibody characterization workflows.
