Recombinant Human Piezo-type mechanosensitive ion channel component 1 (PIEZO1), partial

In Stock
Code: CSB-EP852881HU
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$306
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
PIEZO1
Uniprot NO.
Research Area
Others
Alternative Names
(Membrane protein induced by beta-amyloid treatment)(Mib)(Protein FAM38A)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2198-2431aa
Target Protein Sequence
RSVVGVVNQPIDVTVTLKLGGYEPLFTMSAQQPSIIPFTAQAYEELSRQFDPQPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKRELYNGTADITLRFTWNFQRDLAKGGTVEYANEKHMLALAPNSTARRQLASLLEGTSDQSVVIPNLFPKYIRAPNGPEANPVKQLQPNEEADYLGVRIQLRREQGAGATGFLEWWVIELQECRTDCNLLPMVIFSDKVSPPS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
33.6 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description

The recombinant human PIEZO1 protein is labeled with an N-terminal 10xHis-tagged and C-terminal Myc-tag. It is expressed in the E.coli. The expression region corresponds to the 2198-2431aa of the human PIEZO1. It is subject to affinity chromatography purification. Its purity is over 90% as measured by SDS-PAGE.

Human PIEZO1 functions as a mechanosensitive ion channel and is primarily involved in transducing mechanical stimuli into cellular responses. Upon stimulation by mechanical forces, such as membrane stretch or deformation, PIEZO1 occurs a conformational change, allowing ion influx [1-3]. This mechanotransduction process is vital to regulating calcium signaling, which is crucial for muscle contraction, neurotransmitter release, and cellular signaling pathways [4]. It is a non-selective cation channel that allows the passage of various ions, including Na+, K+, and Ca2+, thereby playing a significant role in various physiological processes such as cell proliferation, differentiation, and apoptosis [5][6].

Research has demonstrated that PIEZO1 is involved in several pathophysiological conditions. The dysregulation of PIEZO1 has been linked to diseases such as multiple sclerosis, where its expression is downregulated in the brain, affecting oligodendrocyte maturation and migration [7]. PIEZO1 has been implicated in cancer biology, influencing tumor progression and immune responses by modulating calcium signaling in immune cells [4].

References:
[1] J. Roh, S. Hwang, S. Lee, K. Lee, Y. Kim, & C. Park, Functional expression of piezo1 in dorsal root ganglion (drg) neurons, International Journal of Molecular Sciences, vol. 21, no. 11, p. 3834, 2020. https://doi.org/10.3390/ijms21113834
[2] M. Yao, A. Tijore, D. Cheng, J. Li, A. Hariharan, B. Martinacet al., Force- and cell state–dependent recruitment of piezo1 drives focal adhesion dynamics and calcium entry, Science Advances, vol. 8, no. 45, 2022. https://doi.org/10.1126/sciadv.abo1461
[3] A. Schröder, K. Neher, B. Krenmayr, E. Paddenberg, G. Spanier, P. Proffet al., Impact of piezo1‐channel on inflammation and osteoclastogenesis mediated via periodontal ligament fibroblasts during mechanical loading, European Journal of Oral Sciences, vol. 131, no. 1, 2023. https://doi.org/10.1111/eos.12913
[4] Y. Wu, J. Zhang, C. Hou, H. Wang, M. Zhu, & X. Yao, A pancancer study of piezo1 as a prognosis and immune biomarker of human tumors, Journal of Oncology, vol. 2022, p. 1-15, 2022. https://doi.org/10.1155/2022/6725570
[5] B. Wang, W. Ke, K. Wang, G. Li, L. Ma, S. Luet al., Mechanosensitive ion channel piezo1 activated by matrix stiffness regulates oxidative stress‐induced senescence and apoptosis in human intervertebral disc degeneration, Oxidative Medicine and Cellular Longevity, vol. 2021, no. 1, 2021. https://doi.org/10.1155/2021/8884922
[6] X. Ren, H. Zhuang, B. Li, F. Jiang, Y. Zhang, & P. Zhou, Gsmtx4 alleviated osteoarthritis through piezo1/calcineurin/nfat1 signaling axis under excessive mechanical strain, International Journal of Molecular Sciences, vol. 24, no. 4, p. 4022, 2023. https://doi.org/10.3390/ijms24044022
[7] M. Velasco‐Estevez, N. Koch, I. Klejbor, F. Caratis, & A. Rutkowska, Mechanoreceptor piezo1 is downregulated in multiple sclerosis brain and is involved in the maturation and migration of oligodendrocytes in vitro, Frontiers in Cellular Neuroscience, vol. 16, 2022. https://doi.org/10.3389/fncel.2022.914985

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Pore-forming subunit of a mechanosensitive non-specific cation channel. Generates currents characterized by a linear current-voltage relationship that are sensitive to ruthenium red and gadolinium. Plays a key role in epithelial cell adhesion by maintaining integrin activation through R-Ras recruitment to the ER, most probably in its activated state, and subsequent stimulation of calpain signaling. In the kidney, may contribute to the detection of intraluminal pressure changes and to urine flow sensing. Acts as shear-stress sensor that promotes endothelial cell organization and alignment in the direction of blood flow through calpain activation. Plays a key role in blood vessel formation and vascular structure in both development and adult physiology. Acts as sensor of phosphatidylserine (PS) flipping at the plasma membrane and governs morphogenesis of muscle cells. In myoblasts, flippase-mediated PS enrichment at the inner leaflet of plasma membrane triggers channel activation and Ca2+ influx followed by Rho GTPases signal transduction, leading to assembly of cortical actomyosin fibers and myotube formation.
Gene References into Functions
  1. Both vertebrate and invertebrate mechanosensitive PIEZO ion channels are polymodal, being voltage modulated, and can even be directly voltage gated following a preceding mechanical stimulus. PMID:29545531
  2. In the absence of extracellular matrix (ECM) proteins Piezo1 receptors are relatively insensitive to mechanical forces pushing the cellular membrane, whereas they can hardly be activated by mechanically pulling the membrane. Yet, if conjugated with Matrigel, a mix of ECM proteins, the receptors become sensitized. PMID:28164706
  3. present study was designed to evaluate in hereditary xerocytosis the functional link between mutated Piezo1 and KCNN4 PMID:28619848
  4. the knockdown of PIEZO1 significantly reduced the cell-viability of SW982 cells. PMID:29757938
  5. analysis of Piezo1 domains by using localized force on magnetic nanoparticles PMID:27694883
  6. Piezo1-shRNA could inhibit the invasion of the osteosarcoma cells. PMID:29065102
  7. Piezo1 plays an important role in the apoptosis of human osteoarthritis-derived chondrocytes through a caspase-12-dependent pathway. PMID:28731145
  8. MiR-103a might be a potential biomarker of myocardium infarction and could be used as an index for the diagnosis of AMI. It may be involved in the development of HBP and onset of AMI through regulating the Piezo1 expression. PMID:27515482
  9. The structural dynamics of the PIEZO1 channel activation and inactivation by coarse-grained modeling has been reported. PMID:28905417
  10. Additional alterations in mutant PIEZO1 channel kinetics, differences in response to osmotic stress, and altered membrane protein trafficking, predicting variant alleles that worsen or ameliorate erythrocyte hydration. PMID:28716860
  11. differential regulation of PKA and cell stiffness in unconfined versus confined cells is abrogated by dual, but not individual, inhibition of Piezo1 and myosin II. PMID:27160899
  12. data demonstrate that PIEZO1 is required for the regulation of NO formation, vascular tone, and blood pressure. PMID:27797339
  13. The Piezo1 convert a variety of mechanical stimuli into channel activation and subsequent inactivation, and what molecules and mechanisms modulate Piezo function. PMID:27743844
  14. Because Piezo1 senses both mechanical crowding and stretch, it may act as a homeostatic sensor to control epithelial cell numbers, triggering extrusion and apoptosis in crowded regions and cell division in sparse regions. PMID:28199303
  15. platelets and Meg-01 cells express the MS cation channel Piezo1, which may contribute to Ca(2+) entry and thrombus formation under arterial shear. PMID:28416610
  16. correlation between HPCHA and PIEZO1-gene mutated findings raise an important question as to whether any of the high phosphatidylcholine hemolytic anemia cases previously diagnosed in Japan may have in fact been the form of hemolytic anemia known as hereditary xerocytosis or dehydrated hereditary stomatocytosis with PIEZO1 gene mutation PMID:26971963
  17. Piezo1 responds to lateral membrane tension with exquisite sensitivity as compared to other mechanically activated channels and that resting tension can drive channel inactivation, thereby tuning overall mechanical sensitivity of Piezo1. PMID:26646186
  18. When the "split protein" is coexpressed, the parts associate to form a normal channel. PMID:26963637
  19. Mutations in PIEZO1 is associated with persistent lymphoedema caused by congenital lymphatic dysplasia. PMID:26387913
  20. Homozygous and compound heterozygous mutations in PIEZO1, result in an autosomal recessive form of generalized lymphatic dysplasia with a high incidence of non-immune hydrops fetalis and childhood onset of facial and four limb lymphoedema. PMID:26333996
  21. Mechanically activated Piezo1 plays an essential role in red blood cell volume homeostasis. PMID:26001274
  22. Piezo1 is amenable to chemical activation and thus there is a possibility that endogenous Piezo1 agonists might exist. PMID:26001275
  23. PIEZO1 is permeable to monovalent ions (K+, Na+, Cs+, Li+) and most divalent ions (Ba2+, Ca2+ and Mg2+), but not to Mn2+. PMID:25955826
  24. a possible role of Piezo1 in invasion and metastatic propagation. PMID:25666479
  25. Piezo1 channels are likely to function in normal RBCs and suggest a previously unidentified mechanotransductive pathway in ATP release. PMID:26351678
  26. study reports two unrelated families with hereditary xerocytosis where probands presented fetal hydrops for which the same heterozygous mutation in PIEZO1 was identified PMID:23581886
  27. PIEZO1 stretch sensitivity is modulated by polycystin-2. PMID:24157948
  28. family of mechanically activated channels that counts only two members in human, piezo1 and 2, has emerged recently. [review] PMID:25037583
  29. Protonation of the human PIEZO1 ion channel stabilizes inactivation. PMID:25561736
  30. the mechanically gated ion channel Piezo1 is an important determinant of mechanosensitive lineage choice in neural stem cells and may play similar roles in other multipotent stem cells. PMID:25349416
  31. Hereditary xerocytosis and familial haemolysis due to mutation in the PIEZO1 gene have been found in a Danish pedigree. PMID:24314002
  32. The R2488Q PIEZO1 mutation is an apparent major cause of familial hereditary xerocytosis. PMID:25044010
  33. Piezo1 is a novel TFF1 binding protein that is important for TFF1-mediated cell migration in gastric cancer cells. PMID:24798994
  34. gating and inactivation as a function of pressure PMID:23972840
  35. The gain-of-function PIEZO1 phenotype provides insight that helps to explain the increased permeability of cations in red blood cells of dehydrated hereditary stomatocytosis patients. PMID:23695678
  36. R2456H and R2488Q mutations in PIEZO1 alter mechanosensitive channel regulation, leading to increased cation transport in erythroid cells. PMID:23479567
  37. Xerocytosis is caused by mutations that alter the kinetics of the mechanosensitive channel PIEZO1. PMID:23487776
  38. Piezo1 responses in a patch emulate many of the responses seen in whole-cell mode, there are significant differences, presumably in the force transfer structures. PMID:22790451
  39. Loss of Fam38A expression may cause increased cell migration and metastasis in lung tumours. PMID:22792288
  40. Data show that the transmission of PIEZO1 mutations and cosegregation with the disease phenotype in all affected persons in both kindreds. PMID:22529292
  41. siRNA knockdown in epithelial cells inactivates endogenous beta1 integrin, reducing cell adhesion PMID:20016066
  42. The MIB index was strongly correlated with disease progression in papillary urothelial neoplasms in the urinary bladder. PMID:18311491

Show More

Hide All

Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane. Cell membrane; Multi-pass membrane protein. Cell projection, lamellipodium membrane. Cell membrane; Multi-pass membrane protein.
Protein Families
PIEZO (TC 1.A.75) family
Tissue Specificity
Expressed in numerous tissues. In normal brain, expressed exclusively in neurons, not in astrocytes. In Alzheimer disease brains, expressed in about half of the activated astrocytes located around classical senile plaques. In Parkinson disease substantia
Database Links

HGNC: 28993

UNIGENE: Hs.377001

KEGG: hsa:9780

STRING: 9606.ENSP00000301015

OMIM: 194380

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products