Recombinant Human Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform (PIK3CG), partial

In Stock
Code: CSB-EP018001HU
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$306
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
PIK3CG
Uniprot NO.
Research Area
Cancer
Alternative Names
PI3-kinase subunit gamma;PI3K-gamma;PI3Kgamma;PtdIns-3-kinase subunit gamma;Phosphatidylinositol 4,5-bisphosphate 3-kinase 110 kDa catalytic subunit gamma;PtdIns-3-kinase subunit p110-gamma;p110gamma;Phosphoinositide-3-kinase catalytic gamma polypeptide;Serine/threonine protein kinase PIK3CG (EC:2.7.11.1);p120-PI3K
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
828-1073aa
Target Protein Sequence
IGIIFKHGDDLRQDMLILQILRIMESIWETESLDLCLLPYGCISTGDKIGMIEIVKDATTIAKIQQSTVGNTGAFKDEVLNHWLKEKSPTEEKFQAAVERFVYSCAGYCVATFVLGIGDRHNDNIMITETGNLFHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSPHFQKFQDICVKAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKNEEDAKKYFLDQIE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
35.4 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Phosphoinositide-3-kinase (PI3K) that phosphorylates PtdIns(4,5)P2 (Phosphatidylinositol 4,5-bisphosphate) to generate phosphatidylinositol 3,4,5-trisphosphate (PIP3). PIP3 plays a key role by recruiting PH domain-containing proteins to the membrane, including AKT1 and PDPK1, activating signaling cascades involved in cell growth, survival, proliferation, motility and morphology. Links G-protein coupled receptor activation to PIP3 production. Involved in immune, inflammatory and allergic responses. Modulates leukocyte chemotaxis to inflammatory sites and in response to chemoattractant agents. May control leukocyte polarization and migration by regulating the spatial accumulation of PIP3 and by regulating the organization of F-actin formation and integrin-based adhesion at the leading edge. Controls motility of dendritic cells. Together with PIK3CD is involved in natural killer (NK) cell development and migration towards the sites of inflammation. Participates in T-lymphocyte migration. Regulates T-lymphocyte proliferation and cytokine production. Together with PIK3CD participates in T-lymphocyte development. Required for B-lymphocyte development and signaling. Together with PIK3CD participates in neutrophil respiratory burst. Together with PIK3CD is involved in neutrophil chemotaxis and extravasation. Together with PIK3CB promotes platelet aggregation and thrombosis. Regulates alpha-IIb/beta-3 integrins (ITGA2B/ ITGB3) adhesive function in platelets downstream of P2Y12 through a lipid kinase activity-independent mechanism. May have also a lipid kinase activity-dependent function in platelet aggregation. Involved in endothelial progenitor cell migration. Negative regulator of cardiac contractility. Modulates cardiac contractility by anchoring protein kinase A (PKA) and PDE3B activation, reducing cAMP levels. Regulates cardiac contractility also by promoting beta-adrenergic receptor internalization by binding to GRK2 and by non-muscle tropomyosin phosphorylation. Also has serine/threonine protein kinase activity: both lipid and protein kinase activities are required for beta-adrenergic receptor endocytosis. May also have a scaffolding role in modulating cardiac contractility. Contributes to cardiac hypertrophy under pathological stress. Through simultaneous binding of PDE3B to RAPGEF3 and PIK3R6 is assembled in a signaling complex in which the PI3K gamma complex is activated by RAPGEF3 and which is involved in angiogenesis.
Gene References into Functions
  1. High PIK3CG expression correlates with low parasitism in human chagasic hearts. These data identify a previously unrecognized role of the canonical PI3Kgamma signaling pathway in the control of T. cruzi infection. PMID:29666415
  2. PIK3CG gene rs12667819 was shown to be associated with attention-deficit/hyperactivity disorder (ADHD) risk in dominant model, ADHD-I type, and symptom scores. Gene-environmental interactions analysis revealed potential interactions of rs12667819 collaborating with blood lead and feeding style to modify ADHD risk. Expression quantitative trait loci analysis suggested that rs12667819 may mediate PIK3CG gene expression. PMID:29097255
  3. Predicted activities were further evaluated through in-vitro testing of gallic acid and serpentine targeting PI3Kgamma. PMID:28359246
  4. we propose that the PKA-Smurf1-PIPKIgamma pathway has an important role in pulmonary tumorigenesis and imposes substantial clinical impact on development of novel diagnostic markers and therapeutic targets for lung cancer treatment. PMID:28581524
  5. A positive correlation may exist between PIK3CG single nucleotide polymorphisms and patients with poor responsiveness to clopidogrel. PMID:28885323
  6. PI3K, independently of protein kinase B, has a role in parasite-induced netosis. One of the main isoforms involved is PI3Kgamma which works in a reactive-oxygen-species-dependent way. PMID:27154356
  7. Diminished expression of p110gamma in pulmonary vascular endothelial cells of patients with acute respiratory distress syndrome suggests that impaired p110gamma-FoxM1 vascular repair signaling is a critical factor in persistent leaky lung microvessels in ARDS. PMID:26839042
  8. Findings suggest the pathophysiological role of phosphoinositide 3-kinase gamma (PI3Kgamma) in atherogenesis. PMID:26658747
  9. Our findings suggest that p84 binding to p110gamma may represent a novel negative feedback signal that terminates PI3Kgamma activity. PMID:25753393
  10. findings suggest that miR-502 functions as a tumor suppressor in HCC via inhibition of PI3KCG, supporting its utility as a promising therapeutic gene target for this tumor type PMID:26163264
  11. PI3Kgamma plays an important role in the development of eosinophilic inflammation a PMID:24333185
  12. PI3Kgamma-induced VEGF expression was reduced when the human tocopherol-associated protein 1 (hTAP1/SEC14L2) was overexpressed suggesting formation of an inactive PI3Kgamma/hTAP1 heterodimer. PMID:25290554
  13. data argue for differential regulatory functions of the non-catalytic subunits and a specific Gbetagamma-dependent regulation of p101 in PI3Kgamma activation. PMID:26173259
  14. The interaction between PI3Kgamma and CNGA1 does not appear to play a role in regulation of CNG channel activity, but PI3Kgamma uses CNGA1 as an anchoring module to achieve close proximity to its substrate to generate D3-phosphoinositides PMID:25644171
  15. Mfng is an oncogene acting through Notch-mediated induction of Pik3cg. PMID:25808869
  16. increased susceptibility of individuals with COPD to influenza likely results from impaired antiviral responses, which are mediated by increased PI3K-p110alpha activity. PMID:25751541
  17. Data indicate class of benzothiazoles as inhibitors of phosphoinositide 3-kinase gamma. PMID:24754609
  18. phosphatidylinositol 3-kinase gamma has a role in insulin secretion induced by glucose-dependent insulinotropic polypeptide PMID:25288806
  19. The data indicate that PI3Kgamma has a critical role in cAMP-mediated inflammatory hypernociception and analgesic signalling via mu-opioid receptors and PI3K/Akt in neuronal cells. PMID:24654606
  20. Binding of the HSV-1 envelope initiates the epidermal growth factor receptor EGFR-PI3K signaling pathway, which leads to virus-induced early cofilin phosphorylation and F-actin polymerization. PMID:24425731
  21. Ablating the interaction of PI3Kgamma with Gbetagamma heterodimers attenuates signaling, chemotaxis, and transformation driven by a GPCR agonist in cell lines. PMID:24190998
  22. Class II enzyme PI3K-C2beta and class IB isozyme p110gamma mainly regulate the S1P- and high density lipoprotein (HDL)-dependent endothelial cell (EC) migration and PI3K-C2alpha primarily controls EC survival PMID:23320105
  23. Assessed the expression of class I PI3K p110 isoforms in idiopathic pulmonary fibrosis lung tissue as well as in tissue-derived fibroblast cell lines. PMID:23439433
  24. kinase-independent function of PI3Kgamma could directly inhibit GSK-3 function by preventing the PP2A-PPMT-1 interaction and that this inhibition of GSK-3 was independent of Akt. PMID:23354687
  25. Upregulated phosphoinositide 3-kinase gamma is a target to suppress breast cancer cell migration and invasion. PMID:23500535
  26. PI3Kgamma plays a key role in ipopolysaccharide-induced ROS generation in alveolar epithelial cells, thereby activating NF-kappaB PMID:22825625
  27. Culturing spermatogonia in vitro at 37 degrees C could inhibit the expression of PI3K and c-kit, and lead to the mutation of the c-kit gene. PMID:22568210
  28. The expression levels of PI3K protein and mRNA in esophageal squamous cell carcinoma tissues are significantly increased and PI3K plays a role in the carcinogenesis and development of ESCC. PMID:22325219
  29. a novel mechanism that links PI3Kgamma activity with chemotaxis and superoxide production in G-protein coupled receptor signaling. PMID:22573891
  30. PI3K might play a role in silica-induced DNA double strand break repair by regulating the expression levels of Ku70 and Ku80 in lung fibroblasts. PMID:20465946
  31. findings suggest that PIK3CG function impacts the severity of the intraparenchymal bleed in patients with intracerebral hemorrhage PMID:22449554
  32. role of p110gamma as a promoter of HCC proliferation and unveil an important cell cycle regulation function of this molecule. PMID:21796621
  33. A novel regulatory role of p101 in the activation of PI3Kgamma. PMID:22054284
  34. Ras-p110gamma interaction is necessary for efficient beta-selection-promoted proliferation but is dispensable for the survival or differentiation of thymocytes. PMID:21930962
  35. protection from insulin resistance, metabolic inflammation, and fatty liver in mice lacking functional PI3Kgamma is largely consequent to their leaner phenotype PMID:21949398
  36. Data show 5-HT can induce activation of two interrelated signaling pathways, Erk1/2 and PI3K/Akt to induce proliferation, migration, and differentiation. PMID:19926313
  37. Activation of the PI3K/Akt/mTOR pathway correlates with tumour progression and reduced survival in patients with urothelial carcinoma of the urinary bladder. PMID:21707707
  38. Once activated, p110gamma promotes inside-out activation of a single integrin, alpha4beta1, causing myeloid cell invasion into tumors. PMID:21665146
  39. PI3Kgamma, a PI3K isoform exhibiting restricted tissue distribution, is strictly required for signaling from the KSHV-encoded vGPCR oncogene to Akt/mTOR. PMID:21665152
  40. Data demonstrate that AG/UAG attenuation of ISO-induced lipolysis involves PI3Kgamma/AKT and PDE3B. PMID:21435395
  41. p110gamma anchors protein kinase A (PKA) through a site in its N-terminal region. Anchored PKA activates PDE3B to enhance cAMP degradation and phosphorylates p110gamma to inhibit PIP(3) production PMID:21474070
  42. C. jejuni activates a PI3K/Akt-dependent anti-inflammatory pathway in human intestinal epithelial cells. PMID:20863633
  43. Data indicate that stathmin is a target of the PI3K/Akt pathway in cervical cancer cells. PMID:20657188
  44. Platelet migration was stimulated by SDF-1 through PI3 kinase dependent mechanism. PMID:20852838
  45. This indicates that not only MAPK activation, but PI3Kgamma protein kinase activity in general is localized in the cytosol. PMID:21185806
  46. Studies indicate that targeting the deregulated PI3K/PTEN-Akt signaling axis has currently emerged as one of the major tenets in anticancer drug development. PMID:20622047
  47. PI3K-PDK1 signaling is essential for viability, MALT1 protease activity, and NF-kappaB activation in activated B-cell-like diffuse large B-cell lymphoma cells that carry mutations in the BCR proximal signaling adaptor CD79B. PMID:21173233
  48. Data demonstrate that PI3K/Akt pathway regulates the expression of DNMT3B at transcriptional and post-transcriptional levels, which is particularly important to understand the effects of PI3K/Akt and DNMT3B on hepatocarcinogenesis. PMID:20506537
  49. Data show an in vitro link between phosphoinositide 3-kinase-mediated HOXA9/HOXA10 expression, and a drug-resistant, progenitor cell phenotype in MGMT-independent pediatric glioblastoma. PMID:20935218
  50. Findings show that oncogenic factors activating the phosphoinositide 3-kinase/Akt pathway can regulate alternative splicing of Casp9 via a coordinated mechanism involving the phosphorylation of SRp30a. PMID:21045158

Show More

Hide All

Subcellular Location
Cytoplasm. Cell membrane.
Protein Families
PI3/PI4-kinase family
Tissue Specificity
Pancreas, skeletal muscle, liver and heart.
Database Links

HGNC: 8978

UNIGENE: Hs.32942

KEGG: hsa:5294

STRING: 9606.ENSP00000352121

OMIM: 601232

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products