Recombinant Human Parathyroid hormone/parathyroid hormone-related peptide receptor (PTH1R), partial (Active)

CSB-MP018988HU
Size:
20ug
20ug100ug1mg
US$98
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: C-terminal 10xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Orders can only be placed from within the U.S.

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human PTH1R at 2 μg/mL can bind Anti-PTH1R recombinant antibody (CSB-RA018988MA1HU). The EC50 is 0.7813-1.048 ng/mL.
Target Names
PTH1R
Uniprot NO.
Alternative Names
Parathyroid hormone/parathyroid hormone-related peptide receptor; PTH/PTHrP type I receptor (PTH/PTHr receptor); Parathyroid hormone 1 receptor (PTH1 receptor); PTH1R; PTHR, PTHR1
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
27-188aa
Target Protein Sequence
DADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLG
Mol. Weight
20.3 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human PTH1R at 2 μg/ml can bind Anti-PTH1R recombinant antibody (CSB-RA018988MA1HU). The EC50 is 0.7813-1.048 ng/mL.
  • PTH1R Recombinant Monoclonal Antibody (CSB-RA018988MA1HU) captured on Protein A Chip can bind Recombinant Human PTH1R protein with an affinity constant of 0.14 nM as detected by MetaSPR Assay (WeSPRTM 200).

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
Receptor for parathyroid hormone and for parathyroid hormone-related peptide. The activity of this receptor is mediated by G proteins which activate adenylyl cyclase and also a phosphatidylinositol-calcium second messenger system.
Gene References into Functions
  1. These results pinpoint the ubiquitinated Lys residues in PTHR controlling MAPK signaling and cell proliferation and survival. PMID:29444827
  2. findings confirm the expression of CaSR in human BM-derived MSCs and unravel a prominent role for the interplay between CaSR and PTH1R in regulating MSC fate and the choice of pathway for bone formation. PMID:29915064
  3. the decreased expression of PTH1R may be the main cause of hypercalcemia in HCC. Decreased expression of PTH1R was associated with tumor size, Edmondson Grade, serum AFP level and poor overall survival, and was a poor prognosis in HCC. PMID:29278884
  4. the results indicated that the beta-alanine induced expression of PTHR1 has a positive relationship with invasion and metastasis of osteosarcoma cells. PMID:29366883
  5. Functional studies (IFA) showed a variation in expression between the WT and mutant PTH1R. In silico analysis showed structural differences between WT and mutant PTH1R proteins, particularly in the regions of the 3rd intracellular loop and the 6th transmembrane domain required for efficient PTH1R function. PMID:28643929
  6. Heterozygous mutations in the ATP4A and PTH1R genes were identified in a family with type I gastric neuroendocrine tumors plus hypothyroidism and rheumatoid arthritis PMID:28474257
  7. It seems likely that Mut-PTH1R may be, at least in part, co-localized with Wt-PTH1R by forming a heterodimer, leading to affect the function to each other in Jansen type metaphyseal chondrodysplasia. PMID:27160269
  8. PTH1R mutation is associated with Primary Failure of Tooth Eruption. PMID:27898723
  9. Data suggest that GCGR (glucagon receptor) activation proceeds via a mechanism in which transmembrane helix 6 (TM6) is held in an inactive conformation by a conserved polar core and a hydrophobic lock (involving intracellular loop 3, IC3); mutations in the corresponding polar core of GCGR or PTH1R disrupt these inhibitory elements, allow TM6 to swing outward, and induce constitutive G protein signaling. PMID:28356352
  10. data highlight sequences in PTHR that contribute to NHERF1 interaction and can be altered to prevent phosphorylation-mediated inhibition PMID:28376304
  11. Overt hypercalcemia is not always encountered in Jansen Metaphyseal Chondrodysplasia due to Heterozygous H223R-PTH1R Mutation. PMID:27410178
  12. data are consistent with the hypothesis that the pattern of C-terminal tail phosphorylation on PTH1R may determine the signaling outcome following receptor activation. PMID:27623777
  13. the data presented in this manuscript demonstrate a critical function of VPS35 in regulating PTH1R trafficking. This event and VPS35-interaction with PPP1R14C appear to be essential for turning off PTH1R's endosomal signaling, and promoting PTH1R-mediated catabolic response and bone remodeling. PMID:27333042
  14. PTH1R mutation causing primary failure of tooth eruption in a consanguineous Saudi family. PMID:27019138
  15. A critical role for SNX27-retromer mediated transport of PTHR in normal bone development. PMID:26912788
  16. PI3K/Akt pathway stimulates the expressions of RANKL, PTHrP, and BMP-2 partly through NF-kappaB, suggesting its importance for bone metastasis of prostate carcinoma PMID:27040945
  17. CaSR and PTH1R signaling responses in cartilage and bone. [review] PMID:26688334
  18. PTHR recycles rapidly through at least two pathways, one involving the ASRT complex of actin, SNX27, and retromer and another possibly involving N-ethylmaleimide-sensitive factor. PMID:27008860
  19. Data suggest affinity of ligands for binding site on PTHR1, either in GTP-binding protein-dependent or -independent conformation, alters duration of action of ligand in target cells; ligands were fragments of PTHRP/parathyroid hormone-related protein. PMID:26562265
  20. This Review discusses current understanding of PTHR1 modes of action and how these findings might be applied in future therapeutic agents--{REVIEW} PMID:26303600
  21. We show that sustained stimulation with PTH leads to diminished potentiation of carbachol-evoked Ca2+ signals. This does not require internalization of PTH1R. PMID:25431134
  22. data indicate that, albeit the similarity in its subcellular distribution, PTH1R in PDL cells exhibits characteristics different from those in MG63 cells, pointing to the cell type specificity of this receptor PMID:23604700
  23. data significantly increase the number of presently known unique PFE-causing PTH1R mutations and provide a series of variants with unclear pathogenicity which will require further in vitro assaying to determine effects on protein structure and function PMID:23771181
  24. PTHR1 signaling is important in maintaining osteosarcoma proliferation and undifferentiated state. PMID:25043296
  25. Treatment of recipient HEK 293a cells transiently expressing PTH1R with PTH-myc CM allowed the labeling of endosomal structures positive for Rab5 and/or for beta-arrestin1. PMID:25128082
  26. evaluation of clinical and radiographic characteristics can heighten the specificity of ruling out suspected PTHR1 involvement in PFE patients PMID:24825834
  27. PTHR concentrations are higher in patients with renal failure; the ratio between oxidized (ox)PTH and non-oxPTH varies substantially in renal failure patients; children have the highest mean as well as maximum n-oxPTH concentrations compared to adults. PMID:23868100
  28. The PTH1R gene was analyzed in six patients clinically diagnosed with primary failure of tooth eruption. PMID:24058597
  29. autosomal dominant mutations of PTH1R that cause PFE may also be associated with osteoarthritis; dose-dependent model may explain isolated PFE and osteoarthritis in absence of other known symptoms in the skeletal system. PMID:24300310
  30. LCPUFAs, EPA and DHA, can activate PTH1R receptor at nanomolar concentrations and consequently provide a putative molecular mechanism for the action of fatty acids in bone PMID:23300710
  31. beta-catenin binds to the PTHR-1 C-tail and switches the downstream signaling pathway from G(alphas)/cAMP to G(alphaq)/Ca(2+), which is a mechanism by which chondrocyte hypertrophy may be regulated through the PTH/PTHrP signal independent of canonical Wnt pathway PMID:23124878
  32. PTHR forms a ternary complex that includes arrestin and Gbetagamma dimer in response to PTH stimulation, which in turn causes an accelerated rate of G(S) activation and increases the steady-state level of activated G(S), leading to prolonged generation of cAMP. PMID:23297229
  33. [review] The PTH1R carboxy-terminal tail directs interactions with a plethora of binding partners, resulting in the activation of many pathways. PMID:21777186
  34. Elevated levels of PTH1R expression were associated with breast cancer patients with diabetes. PMID:21312071
  35. PTH(1-34) promotes coupled PTHR ubiquitination and deubiquitination, whereas PTH(7-34) activates only ubiquitination, thereby leading to PTHR downregulation. PMID:21898592
  36. Constitutive expression of PTHrP receptor type 1 in human bone marrow stromal cells declines with age. PMID:21518242
  37. PTH-receptors regulate norepinephrine release in human heart and kidney PMID:21756942
  38. Dynamic Na+-H+ exchanger regulatory factor-1 association and dissociation regulate parathyroid hormone receptor trafficking at membrane microdomains PMID:21832055
  39. Ezrin promotes PTH1R mediated signaling via phospholipase and PIP2 depletion impedes receptor cell surface expression in HEK293 cells. PMID:21672629
  40. A novel variant of parathyroid hormone 1 receptor gene (PTH1R), R383Q, was cosegregated in the first primary failure of tooth eruption family. PMID:21404329
  41. Study shows that binding to beta-arrestin1 prolongs rather than terminates the generation of cAMP by PTHR, and that cAMP generation correlates with the persistence of arrestin-receptor complexes on endosomes. PMID:21445058
  42. Its genetic defect leads to chondrodysplasia. (review) PMID:20890029
  43. NHERF1 may serve as an adaptor, bringing beta-arrestin2 into close proximity to the PTHR, thereby facilitating beta-arrestin2 recruitment after receptor activation. PMID:20656684
  44. Vascular smooth muscle PTH1R activity inhibits arteriosclerotic Wnt/beta-catenin signaling and reduces vascular oxidative stress, thus limiting aortic type I collagen and calcium accrual in diabetic LDLR-deficient mice. PMID:20489161
  45. In both central and peripheral giant cell granulomas of the jaws, PTHR1 was abundantly expressed by type I multinucleated giant cells and mononucleated stromal cells with vesicular nuclei. PMID:20060342
  46. The crystal structure of the ligand-free PTH1R extracellular domain (ECD) reveals a dimer in which the C-terminal segment of both ECD protomers forms an alpha-helix that mimics PTH/PTHrP by occupying the peptide binding groove of the opposing protomer. PMID:20172855
  47. TGFBR2 forms an endocytic complex with PTH1R in response to PTH and regulates signalling by PTH and TGF-beta. TGFBR2 directly phosphorylates the PTH1R cytoplasmic domain, which modulates PTH-induced endocytosis of the PTH1R-TGFBR2 complex. PMID:20139972
  48. Agonist-regulated cleavage of the extracellular domain of parathyroid hormone receptor type 1 PMID:20080964
  49. A PTH1R mutation is strongly associated with failure of orthodontically assisted eruption or tooth movement; specific treatments are discussed. PMID:20152661
  50. different domains of PTHR implicated in agonist-dependent receptor internalization; the receptor's core (Asn-289 and Lys-382) appears to regulate internalization of the receptor/beta-arrestin complex toward early endocytic endosomes during endocytosis. PMID:11726668

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 2 family
Tissue Specificity
Expressed in most tissues. Most abundant in kidney, bone and liver.
Database Links

HGNC: 9608

UNIGENE: Hs.1019

KEGG: hsa:5745

STRING: 9606.ENSP00000321999

OMIM: 125350

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products