Abbreviation
Recombinant Human PTH1R protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human PTH1R at 2 μg/mL can bind Anti-PTH1R recombinant antibody (CSB-RA018988MA1HU). The EC50 is 0.7813-1.048 ng/mL.
Alternative Names
Parathyroid hormone/parathyroid hormone-related peptide receptor; PTH/PTHrP type I receptor (PTH/PTHr receptor); Parathyroid hormone 1 receptor (PTH1 receptor); PTH1R; PTHR, PTHR1
Species
Homo sapiens (Human)
Expression Region
27-188aa
Target Protein Sequence
DADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLG
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Storage
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human PTH1R at 2 μg/ml can bind Anti-PTH1R recombinant antibody (CSB-RA018988MA1HU). The EC50 is 0.7813-1.048 ng/mL.
-
PTH1R Recombinant Monoclonal Antibody (CSB-RA018988MA1HU) captured on Protein A Chip can bind Recombinant Human PTH1R protein with an affinity constant of 0.14 nM as detected by MetaSPR Assay (WeSPRTM 200).
Description
PTH1R mediates the skeletal and renal actions of parathyroid hormone and parathyroid hormone-related peptide, making its extracellular domain a critical target for therapeutic antibody development and small-molecule screening in metabolic bone disease research. This partial construct spans residues 27–188, capturing the N-terminal extracellular ligand-binding domain, and demonstrates quantifiable binding activity with an EC50 of 0.7813–1.048 ng/mL against an anti-PTH1R recombinant antibody in functional ELISA, confirming that the mammalian expression system preserves conformational epitopes required for antibody recognition. The validated binding profile supports its use in competitive inhibition assays, therapeutic antibody epitope mapping, and blocking antibody screening, where native receptor conformation is essential for identifying clinically relevant binders. With purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this protein meets the quality thresholds commonly required for surface plasmon resonance, bio-layer interferometry, and high-throughput ligand-binding screens in drug discovery programs targeting PTH1R signaling pathways.