Recombinant Human Nuclear factor NF-kappa-B p100 subunit (NFKB2), partial

Code
MSDS
Size Pls inquire
Source
Conjugate
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
NFKB2
Uniprot NO.
Alternative Names
Nuclear factor NF-kappa-B p100 subunit; DNA-binding factor KBF2; H2TF1; Lymphocyte translocation chromosome 10 protein; Nuclear factor of kappa light polypeptide gene enhancer in B-cells 2; Oncogene Lyt-10; Lyt10; [Cleaved into: Nuclear factor NF-kappa-B p52 subunit] NFKB2 LYT10
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
38-343
Target Protein Sequence
PYLVIVEQPKQRGFRFRYGCEGPSHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGICAVSVGPKDMTAQFNNLGVLHVTKKNMMGTMIQKLQRQRLRSRPQGLTEAEQRELEQEAKELKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSVRGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIERPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKAL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
NF-kappa-B is a pleiotropic transcription factor present in almost all cell types and is the endpoint of a series of signal transduction events that are initiated by a vast array of stimuli related to many biological processes such as inflammation, immunity, differentiation, cell growth, tumorigenesis and apoptosis. NF-kappa-B is a homo- or heterodimeric complex formed by the Rel-like domain-containing proteins RELA/p65, RELB, NFKB1/p105, NFKB1/p50, REL and NFKB2/p52. The dimers bind at kappa-B sites in the DNA of their target genes and the individual dimers have distinct preferences for different kappa-B sites that they can bind with distinguishable affinity and specificity. Different dimer combinations act as transcriptional activators or repressors, respectively. NF-kappa-B is controlled by various mechanisms of post-translational modification and subcellular compartmentalization as well as by interactions with other cofactors or corepressors. NF-kappa-B complexes are held in the cytoplasm in an inactive state complexed with members of the NF-kappa-B inhibitor (I-kappa-B) family. In a conventional activation pathway, I-kappa-B is phosphorylated by I-kappa-B kinases (IKKs) in response to different activators, subsequently degraded thus liberating the active NF-kappa-B complex which translocates to the nucleus. In a non-canonical activation pathway, the MAP3K14-activated CHUK/IKKA homodimer phosphorylates NFKB2/p100 associated with RelB, inducing its proteolytic processing to NFKB2/p52 and the formation of NF-kappa-B RelB-p52 complexes. The NF-kappa-B heterodimeric RelB-p52 complex is a transcriptional activator. The NF-kappa-B p52-p52 homodimer is a transcriptional repressor. NFKB2 appears to have dual functions such as cytoplasmic retention of attached NF-kappa-B proteins by p100 and generation of p52 by a cotranslational processing. The proteasome-mediated process ensures the production of both p52 and p100 and preserves their independent function. p52 binds to the kappa-B consensus sequence 5'-GGRNNYYCC-3', located in the enhancer region of genes involved in immune response and acute phase reactions. p52 and p100 are respectively the minor and major form; the processing of p100 being relatively poor. Isoform p49 is a subunit of the NF-kappa-B protein complex, which stimulates the HIV enhancer in synergy with p65. In concert with RELB, regulates the circadian clock by repressing the transcriptional activator activity of the CLOCK-ARNTL/BMAL1 heterodimer.
Gene References into Functions
  1. Functional evaluation of natural killer cell cytotoxic activity in NFKB2-mutated patients. PMID:29278687
  2. the present study demonstrated that NFKB2 may be involved in the development of HL by interacting with several genes and miRNAs, including BCL2L1, CSF2, miR-135a-5p, miR-155-5p and miR-9-5p. PMID:29693141
  3. TNF-alpha-induced expression of transport protein genes in HUVEC cells is associated with enhanced expression of RELB and NFKB2. PMID:29658079
  4. This study demonstrated that NF-kappaB mRNA levels were significantly decreased in the new cases of untreated MS patients in comparison to healthy controls. PMID:28433998
  5. our studies for the first time establish p100 as a key tumor suppressor of bladder cancer growth PMID:27095572
  6. results suggest that changes in the relative concentrations of RelB, NIK:IKK1, and p100 during noncanonical signaling modulate this transitional complex and are critical for maintaining the fine balance between the processing and protection of p100. PMID:27678221
  7. report a detailed state-of-the-art mass spectrometry-based protein-protein interaction network including the noncanonical NF-kappaB signaling nodes TRAF2, TRAF3, IKKalpha, NIK, and NF-kappaB2/p100. PMID:27416764
  8. novel NFKB2 gain-of-function mutations produce a nonfully penetrant combined immunodeficiency phenotype through a different pathophysiologic mechanism than previously described for mutations in NFKB2 PMID:28778864
  9. a new ERK2/AP-1/miR-494/PTEN pathway that is responsible for the tumor-suppressive role of NFkappaB2 p100 in cellular transformation. PMID:26686085
  10. MKK4 activates non-canonical NFkappaB signaling by promoting NFkappaB2-p100 processing. PMID:28733031
  11. the aberrant proliferative capacity of Brca1(-/-) luminal progenitor cells is linked to the replication-associated DNA damage response, where proliferation of mammary progenitors is perpetuated by damage-induced, autologous NF-kappaB signaling. PMID:27292187
  12. RelB is processed by CO2 in a manner dependent on a key C-terminal domain located in its transactivation domain. Loss of the RelB transactivation domain alters NF-kappaB-dependent transcriptional activity, and loss of p100 alters sensitivity of RelB to CO2 PMID:28507099
  13. Thyroidal NF-kappaB2 (noncanonical) activity is more pronounced in Graves disease than in normal thyroids. PMID:27929668
  14. Gene expression levels of NF-kappaB2 were deregulated in 49 B-cell chronic lymphocytic leukemia, 8 B-cell non-Hodgkin's lymphoma, 3 acute myeloid leukemia, 3 chronic myeloid leukemia, 2 hairy cell leukemia, 2 myelodysplastic syndrome, and 2 T-cell large granular lymphocytic leukemia patients in the post-Chernobyl period. PMID:25912249
  15. melatonin transcriptionally inhibited MMP-9 by reducing p65- and p52-DNA-binding activities. Moreover, the Akt-mediated JNK1/2 and ERK1/2 signaling pathways were involved in melatonin-regulated MMP-9 transactivation and cell motility. PMID:26732239
  16. results suggest that glucocorticoids induce a transcription complex consisting of RelB/p52, CBP, and HDAC1 that triggers a dynamic acetylation-mediated epigenetic change to induce CRH expression in full-term human placenta. PMID:26307012
  17. HDAC4-RelB-p52 complex maintains repressive chromatin around proapoptotic genes Bim and BMF and regulates multiple myeloma survival and growth PMID:26455434
  18. The augmentation of methylation in the NFkB2 promoter by interval walking training is advantageous in promoting a healthy state by ameliorating the susceptibility to inflammation PMID:25901949
  19. Data show that NF-kappa-B p52 subunit (p52) interacts with ets transcription factors ETS1/2 factors at the C250T telomerase (TERT) promoter to mediate TERT reactivation. PMID:26389665
  20. mutation results in common variable immunodeficiency with reduction in B cells, memory B cells and T follicular helper cells PMID:24888602
  21. Results confirm previous findings that de novo mutations near the C-terminus of NFKB2 cause combined endocrine and immunodeficiencies. PMID:25524009
  22. The unique ability of p100/IkappaBdelta to stably interact with all NF-kappaB subunits by forming kappaBsomes demonstrates its importance in sequestering NF-kappaB subunits and releasing them as dictated by specific stimuli for developmental programs. PMID:25349408
  23. NIK plays a key role in constitutive NF-kappaB activation and the progression of ovarian cancer cells PMID:24533079
  24. We report 3 related individuals with a novel form of severe B-cell deficiency associated with partial persistence of serum immunoglobulin arising from a missense mutation in NFKB2. PMID:25237204
  25. NFkappaB2/p100 was overexpressed and accumulated in a well-established in vitro human monocyte model of Endotoxin tolerance. The p100 accumulation in these cells inversely correlated with the inflammatory response after LPS stimulation. PMID:25225662
  26. NFKB2 genetic variation associated with sleep disorders in patients, diagnosed with breast cancer. PMID:24012192
  27. higher level of expression is associated with death in non-small cell lung cancer PMID:24355259
  28. NF-kappaB2/p100 deficiency caused a predominant B-cell-intrinsic TI-2 defect that could largely be attributed to impaired proliferation of plasmablasts. Importantly, p100 was also necessary for efficient defense against clinically relevant TI-2 pathogens. PMID:24242887
  29. NFKB2 binds to the PLK4 promoter at upstream and downstream of the PLK4 transcription initiation site abd reduced PLK4 mRNA and protein levels. PMID:23974100
  30. our study demonstrates a link between persistent activation of the AR by NF-kappaB2/p52 and development of resistance to enzalutamide in prostate cancer. PMID:23699654
  31. Single nucleotide polymorphisms of angiotensin-converting enzyme (ACE), nuclear factor kappa B (NFkB)and cholesteryl ester transport protein (CETP) were evaluated in nonagenarians, centenarians, and average life span individuals (controls). PMID:23389097
  32. Heterozygous mutations in NFKB2 cause a unique form of early-onset CVID that also presents with central adrenal insufficiency. PMID:24140114
  33. Constitutive processing of C-terminal truncation mutants of p100 is associated with their active nuclear translocation. Mutation of the nuclear localization signal (NLS) of p100 abolishes its processing. PMID:12894228
  34. Sp1 is required for IL-15 induction by both poly(I:C) and respiratory syncytial virus, a response that also requires NFkappaB2 and IKKepsilon. PMID:23873932
  35. TRAF2/NIK/NF-kappaB2 pathway regulates pancreatic ductal adenocarcinoma cell tumorigenicity PMID:23301098
  36. the FBXW7alpha-dependent degradation of p100 functions as a prosurvival mechanism through control of NF-kappaB activity. PMID:23211527
  37. These findings provide a mouse model for human multiple myeloma with aberrant NF-kappaB2 activation and suggest a molecular mechanism for NF-kappaB2 signaling in the pathogenesis of plasma cell tumors. PMID:22642622
  38. RelB/NF-kappaB2, is constitutively activated in the human placenta, which binds to a previously undescribed NF-kappaB enhancer of corticotropin-releasing hormone (CRH) gene promoter to regulate CRH expression. PMID:22734038
  39. The noncanonical NF-kappaB pathway is integral in controlling immunoregulatory phenotypes of both plasmacytoid and conventional dendritic cells. PMID:22879398
  40. Fbw7-mediated destruction of p100 is a regulatory component restricting the response to NF-kappaB2 pathway stimulation. PMID:22864569
  41. Flt3ITD promotes a noncanonical pathway via TAK1 and p52NF-kappaB to suppress DAPK1 in association with histone deacetylases, which explains DAPK1 repression in Flt3ITD(+) acute myeloid leukemia. PMID:22096027
  42. NF-kappaB2 exhibits the major inhibitory role in the transcription at the CD99 promoter PMID:22083306
  43. mutant p53 elevates expression of genes capable of enhancing cell proliferation, motility, and tumorigenicity by inducing acetylation of histones via recruitment of CBP and STAT2 on the promoters causing CBP-mediated histone acetylation PMID:22198284
  44. Total expression of nuclear factor kappa B-2 was not significantly changed in melphalan resistance in multiple myeloma, but more of the protein population was converted into the p52 isoform PMID:21846842
  45. The activation profile of diffuse large B-cell lymphomas/posttransplantation lymphoproliferative disorders was not associated with BAFF/BAFF-R expression, whereas nuclear p52 activation might be linked to Epstein-Barr virus. PMID:21871426
  46. Data show that IKBalpha, NFKB2, and TRAF3 gene polymorphisms play a role in the development of multiple myeloma and in the response to bortezomib therapy. PMID:21228035
  47. Data show that MEKK-1 plays an integral role in IL-1beta modulation of Caco-2 TJ barrier function by regulating the activation of the canonical NF-kappaB pathway and the MLCK gene. PMID:21048223
  48. Role of NFKB2 on the early myeloid differentiation of CD34+ hematopoietic stem/progenitor cells PMID:20708837
  49. NF-kappaB2/p52 may play a critical role in the progression of castration-resistant prostate cancer through activation of the androgen receptor PMID:20388792
  50. Data demonstrate in various tumor cell lines and primary T-cells that TNFR2, but not TNFR1, induces activation of the alternative NFkappaB pathway and p100 processing. PMID:20038584

Show More

Hide All

Subcellular Location
Nucleus. Cytoplasm. Note=Nuclear, but also found in the cytoplasm in an inactive form complexed to an inhibitor (I-kappa-B).
Database Links

HGNC: 7795

UNIGENE: Hs.73090

KEGG: hsa:4791

STRING: 9606.ENSP00000358983

OMIM: 164012

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1