Recombinant Human NAD-dependent protein deacetylase sirtuin-3, mitochondrial (SIRT3), partial

In Stock
Code: CSB-EP882102HU1
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$256
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: C-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Target Names
SIRT3
Uniprot NO.
Research Area
Cancer
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
118-399aa
Target Protein Sequence
SDKGKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIPASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQRFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDVAQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
32.3 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
NAD-dependent protein deacetylase. Activates or deactivates mitochondrial target proteins by deacetylating key lysine residues. Known targets include ACSS1, IDH, GDH, SOD2, PDHA1, LCAD, SDHA and the ATP synthase subunit ATP5PO. Contributes to the regulation of the cellular energy metabolism. Important for regulating tissue-specific ATP levels. In response to metabolic stress, deacetylates transcription factor FOXO3 and recruits FOXO3 and mitochondrial RNA polymerase POLRMT to mtDNA to promote mtDNA transcription. Acts as a regulator of ceramide metabolism by mediating deacetylation of ceramide synthases CERS1, CERS2 and CERS6, thereby increasing their activity and promoting mitochondrial ceramide accumulation.
Gene References into Functions
  1. genetic manipulation of Sirt3 revealed that amyloid-beta increased levels of total tau acetylated tau through its modulation of Sirt3. PMID:29574628
  2. The SIRT3 protein level negatively correlated with advanced glycation end products accumulation and the grade of intervertebral disc degeneration degeneration. PMID:30216853
  3. Melatonin's functions in the mitochondria are highly diverse, not unlike those of sirtuin 3 (SIRT3). SIRT3 is an NAD+-dependent deacetylase which regulates, among many functions, the redox state of the mitochondria. Recent data proves that melatonin and SIRT3 post-translationally collaborate in regulating free radical generation and removal from mitochondria. [review] PMID:30126181
  4. Master athletes had lower levels of miR-7, while mRNA or protein levels of SIRT3, SIRT1, SOD2, and FOXO1 levels were significantly higher in the vastus lateralis muscle of master athletes compared to muscles of age-matched controls. PMID:30107294
  5. BER modulated autophagy in DOX-treated H9c2 cardiomyoblasts. Interestingly, mitochondrial biogenesis markers were upregulated in in BER/DOX-treated cells. Sirt3 over-expression contributes to decrease DOX cytotoxicity on H9c2 cardiomyoblasts, while BER can be used as a modulator of Sirtuin function and cell quality control pathways to decrease DOX toxicity. PMID:28760703
  6. The loss of Sirt3 triggered fatal mitochondrial fission by suppressing the Akt/PTEN pathway. PMID:30021354
  7. Insulin signaling pathway protects neuronal cell lines by Sirt3 mediated IRS2 activation. PMID:29411439
  8. De novo expression of transfected Sirt3 enhances susceptibility of human epithelial breast cancer cells to hyperoxia treatment. PMID:29683756
  9. mitochondria are present at the leading edge of migrating cells, SIRT3 expression is down-regulated during migration, resulting in elevated ROS levels. This SIRT3-mediated control of ROS represses Src oxidation and attenuates focal adhesion kinase (FAK) activation. PMID:29915029
  10. Median sirtuin-3 levels were significantly higher in patients with esophageal squamous cell carcinoma than in the control subjects PMID:29243781
  11. that down-regulated SIRT3 may contribute to tumor progression and gloomy prognosis in pancreatic carcinoma patients PMID:28867266
  12. SIRT3 expression is associated with the development and progression of NSCLC. PMID:28947845
  13. Results suggested that SIRT3 protected hepatocytes against oxidative stress by enhancing ROS scavenging and maintaining mitochondrial integrity. PMID:29072685
  14. MnSOD is the major superoxide scavenger in mitochondria, whose activity is regulated by SIRT3-mediated deacetylation, particularly at the Lys68 site, and can be enhanced by a SIRT3 coumarin derivative. PMID:28711502
  15. Report an inverse relationship of age with human serum FOXO3A and SIRT3 levels. PMID:28526626
  16. Increase in muscle mitochondrial SIRT3 was observed only following aerobic training. In contrast, resistance training increased muscle mass without improving SIRT3 in obese male adolescents. PMID:29220206
  17. SIRT3-deficient macrophages displayed impaired autophagy and accelerated NLRP3 inflammasome activation and endothelial dysfunction. PMID:29277324
  18. This study investigated the role of SIRT3 in MSC differentiation and aging. As MSCs were expanded ex vivo, SIRT3 levels decreased. In addition, SIRT3 depletion reduced MSC differentiation into adipocytes and osteoblasts. Overexpression of SIRT3 in later-passage MSCs reduced aging-related senescence, reduced oxidative stress, and enhanced their ability to differentiate. PMID:28717408
  19. UCP2 regulates the activity of SIRT3 through sensing the energy level and, in turn, maintaining the mitochondrial steady state, which demonstrates a cytoprotective effect on ischemia-reperfusion injury. PMID:28737710
  20. Authors have identified a novel mechanism by which P53 was inactivated via SIRT3 in PTEN-deficient cells. This may shed light on the mechanisms underlying the malignancy of PTEN-deficient NSCLC. PMID:29103158
  21. SIRT3 could enhance the drug sensitivity of hepatoma cells to an array of chemotherapeutic agents through glutathione S-transferase pi 1/JNK signaling pathway PMID:27367026
  22. Data suggest that pharmacological approaches for augmenting sirtuin 3 (SIRT3) might have therapeutic potential in organ fibrosis in systemic sclerosis (SSc). PMID:27732568
  23. Since mitochondrial ATP regeneration is inevitably linked to the maintenance of cardiac pump function, it is not surprising that recent studies revealed a role for mitochondrial sirtuins in the regulation of myocardial energetics and function. In addition, mitochondrial sirtuins modulate the extent of myocardial ischemia reperfusion injury and the development of cardiac hypertrophy and failure. [review] PMID:27295248
  24. Sirtuin 3 protects against urban particulate matter-induced autophagy in human bronchial epithelial cells. PMID:27125970
  25. Contrary to what has been known in solid tumors, in K562 human leukemia cells, Sirt3 plays an opposite role in relieving oxidative stress. Basal but not enhanced autophagy activity maintains ubiquitination-proteasomal degradation of Sirt3 to limit reactive oxygen species level. PMID:27232755
  26. SIRT3 whole muscle protein content was unaltered after fasting. PMID:27337034
  27. Current study reveal Sirt3 as a novel regulator coupling mitophagy and apoptosis, two important cellular processes that determine cellular survival and death. PMID:27270321
  28. Results show that curcumin at low doses can increase the level of sirtuins including sirtuin 1 and sirtuin 3) without delaying senescence of vascular smooth muscle (VSMC) cells. PMID:27034011
  29. survival curves showed that higher SIRT3 expression is correlated to a poorer prognosis for patients with grade 3 breast cancer. In conclusion, SIRT3 could be a therapeutic target for breast cancer, improving the effectiveness of CDDP and TAM treatments. PMID:27420645
  30. In human myometrium, SIRT3 expression decreases with term labor and regulates the mediators involved in the terminal effector pathways of human labor and delivery through the NFkappaB1 pathway. PMID:27628218
  31. Mitochondria-targeted esculetin has anti-atherosclerotic effects by inhibiting PAI-1 levels by modulating miR-19b and -30c expression and affecting SIRT3- and STAT3-mediated signaling pathways. PMID:28213977
  32. the activation of the SIRT3 axis of the UPRmt is linked to metastasis. PMID:28368421
  33. these results suggest a potential relationship between SIRT3 enzymatic activity, IDH2-K413 acetylation-determined dimerization, and a cancer-permissive phenotype PMID:28536275
  34. These data suggest a novel role for SIRT3 deficiency in mediating alveolar epithelial cell mtDNA damage, apoptosis, and lung fibrosis.- PMID:28258190
  35. Data suggested a protective role of the SIRT3 single-nucleotide polymorphism rs4980329 in ALS risk. PMID:28239025
  36. Low SIRT3 expression is associated with metastasis and epithelial-mesenchymal transition in hepatocellular carcinoma. PMID:28429188
  37. Low SIRT3 expression is associated with Prostate Cancer. PMID:28108513
  38. SIRT3 expression was significantly associated with overall survival in gastric cancer (HR = 0.62, 95% CI = 0.43-0.89, P = 0.009) and hepatocellular carcinoma patients (HR = 0.56, 95% CI = 0.42-0.74, P<0.0001), cancer/non-cancer tissues in hepatocellular carcinoma patients (OR = 0.04, 95% CI = 0.01-0.16, P<0.0001), lymph node metastasis in breast cancer patients (OR = 2.20, 95% CI = 1.49-3.26, P<0.0001). PMID:27483432
  39. he data demonstrated that linalool exhibited inhibitory effect on glioma cells through regulation of SIRT3-SOD2-ROS signaling PMID:28567457
  40. SIRT3 promotes the malignancy of non-small cell lung cancer, showing an oncogenic preference towards squamous cell carcinoma, and that could represent a novel target for treatment. PMID:28197634
  41. These data demonstrate a critical role of SIRT3 in the control of myofibroblast differentiation and lung fibrosis. PMID:27815257
  42. this article indicates a novel functional interplay between estrogen receptor beta and sirtuin-3 counteracting reactive oxygen species production in TCam-2 cells. Our findings thus show that an important tumor-suppressive pathway through estrogen receptor beta is target of E2, actually proposing a distinctive protecting action against seminoma. PMID:28459202
  43. Hence, we conclude that SIRT3 exhibits neuroprotection via deacetylating and increasing mitochondrial enzyme activities. PMID:28161643
  44. In conclusion, our data suggest that Sirt3 overexpression antagonize high glucose-induced apoptosis by controlling ROS accumulation and ROS-sensitive Akt/FoxO signaling pathway in HK-2 cells. PMID:27773814
  45. These results suggest that Sirt3 may inhibit retinal neovascularization by regulating the migration-, neovascularization- and autophagy-related factors expression. Thus we argue that Sirt3 may be a potential candidate drug for curing various eye diseases induced by retinal neovascularization. PMID:27856259
  46. cells with low SIRT1 levels can maintain their resistance and survival by increasing SIRT3 expression. PMID:27925196
  47. Our findings suggest that Sirt3 plays a tumor-progressive role in human RCC by regulating glutamine-derived mitochondrial respiration, particularly in cells where mitochondrial usage of cytosolic pyruvate is severely compromised. PMID:27114304
  48. SIRT3 is decreased in the metastatic tissues and highly metastatic cell line of ovarian carcinoma. SIRT3 suppresses ovarian cancer cell migration and invasion in vitro. PMID:27216459
  49. Interaction of SIRT3 with the palmitoyl group led to unfolding of the alpha3-helix. The myristoyl and palmitoyl groups bind to the C-pocket and an allosteric site near the alpha3-helix, respectively. PMID:27501476
  50. data suggested an important role of SIRT3 in regulating endothelial progenitor cell bioactivity PMID:28032248

Show More

Hide All

Subcellular Location
Mitochondrion matrix.
Protein Families
Sirtuin family, Class I subfamily
Tissue Specificity
Widely expressed.
Database Links

HGNC: 14931

UNIGENE: Hs.716456

KEGG: hsa:23410

STRING: 9606.ENSP00000372191

OMIM: 604481

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products