SRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFP
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
35.0kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Metalloreductase that has the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1+). Uses NAD(+) as acceptor.
Gene References into Functions
High STEAP1 expression is associated with prostate cancer.PMID:29464393
Data suggest a solid basis for further research into understanding how six-transmembrane epithelial antigen of prostate member 1 (STEAP1) activities may affect cancer progression.PMID:27792302
These findings highlight the ability of immuno-PET with (89)Zr-2109A to detect acute changes in STEAP1 expressionPMID:25453051
Data indicate that six transmembrane epithelial antigen of the prostate 1 (STEAP1) is consistently overexpressed in malignant prostate tissue, namely adenocarcinoma and prostatic intraepithelial neoplasia (PIN) lesions.PMID:24239460
The findings provide evidence that STEAP1 is a biomarker of worse prognosis in prostate carcinomas patients.PMID:24025158
STEAP1 is down-regulated by dihydrotestosterone and estradiols in LNCaP cells and in rat prostate.PMID:23060075
A total of 62.3% of the Ewing's Sarcoma samples displayed detectable STEAP1 expression with predominant localization of the protein at the plasma membrane.PMID:22317770
STEAP1 is associated with the invasive behavior and oxidative stress phenotype of Ewing tumors, an unanticipated oncogenic function of STEAP1.PMID:22080479
STEAP1 overexpression predicts improved outcome of Ewing's sarcoma patients, possibly due to enhanced sensitivity towards ROS-generating chemotherapeutics.PMID:22317770
EWS-FLI1 mediated overexpression of STEAP1 increases the invasiveness and oxidative stress levels of Ewing tumor cells.PMID:22080479
Data suggest that zoledronic acid may affect cancer cells also by targeting the gene expression of STEAP.PMID:19915386
Peptide STEAP-292.2L (MLAVFLPIV) may have potential as an antitumor peptide vaccine.PMID:15958640
STEAP mRNA is used here as a marker to evaluate biological samples from individuals suspected of having cancers, and may provide prognostic information useful in defining appropriate therapeutic options.PMID:18793824
STEAP1 is over-expressed in breast cancer and down-regulated by 17beta-estradiol.PMID:18958632
STEAPs may represent novel markers of mesenchymal stem cells in man as well as mice.PMID:19196137
Show
More
Hide
All
Subcellular Location
Endosome membrane; Multi-pass membrane protein.
Protein Families
STEAP family
Tissue Specificity
Ubiquitously expressed. Highly expressed in prostate tumors.