Home
Product
Protein
Recombinant Proteins
Recombinant Human Metalloreductase STEAP1 (STEAP1), partial

Recombinant Human Metalloreductase STEAP1 (STEAP1), partial

Discontinued

Code: CSB-RP133544h

Rate （N/A）
Review （0）

Size:

20ug100ug1mg(1mg*1 or 500ug*2)

US$224

Quantity:

Express system: E.coli

Species: Homo sapiens (Human)

Tag Info: N-terminal GST-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

STEAP1

Uniprot NO.

Q9UHE8

Research Area

Transport

Alternative Names

STEAP1; PRSS24; STEAP; Metalloreductase STEAP1; Six-transmembrane epithelial antigen of prostate 1

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

3-69aa

Target Protein Sequence

SRKDITNQEELWKMKPRRNLEEDDYLHKDTGETSMLKRPVLLHLHQTAHADEFDCPSELQHTQELFP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

35.0kDa

Protein Length

Partial

Tag Info

N-terminal GST-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

Tris-based buffer,50% glycerol

Storage Condition

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Metalloreductase that has the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1+). Uses NAD(+) as acceptor.

Gene References into Functions

High STEAP1 expression is associated with prostate cancer. PMID:29464393
Data suggest a solid basis for further research into understanding how six-transmembrane epithelial antigen of prostate member 1 (STEAP1) activities may affect cancer progression. PMID:27792302
These findings highlight the ability of immuno-PET with (89)Zr-2109A to detect acute changes in STEAP1 expression PMID:25453051
Data indicate that six transmembrane epithelial antigen of the prostate 1 (STEAP1) is consistently overexpressed in malignant prostate tissue, namely adenocarcinoma and prostatic intraepithelial neoplasia (PIN) lesions. PMID:24239460
The findings provide evidence that STEAP1 is a biomarker of worse prognosis in prostate carcinomas patients. PMID:24025158
STEAP1 is down-regulated by dihydrotestosterone and estradiols in LNCaP cells and in rat prostate. PMID:23060075
A total of 62.3% of the Ewing's Sarcoma samples displayed detectable STEAP1 expression with predominant localization of the protein at the plasma membrane. PMID:22317770
STEAP1 is associated with the invasive behavior and oxidative stress phenotype of Ewing tumors, an unanticipated oncogenic function of STEAP1. PMID:22080479
STEAP1 overexpression predicts improved outcome of Ewing's sarcoma patients, possibly due to enhanced sensitivity towards ROS-generating chemotherapeutics. PMID:22317770
EWS-FLI1 mediated overexpression of STEAP1 increases the invasiveness and oxidative stress levels of Ewing tumor cells. PMID:22080479
Data suggest that zoledronic acid may affect cancer cells also by targeting the gene expression of STEAP. PMID:19915386
Peptide STEAP-292.2L (MLAVFLPIV) may have potential as an antitumor peptide vaccine. PMID:15958640
STEAP mRNA is used here as a marker to evaluate biological samples from individuals suspected of having cancers, and may provide prognostic information useful in defining appropriate therapeutic options. PMID:18793824
STEAP1 is over-expressed in breast cancer and down-regulated by 17beta-estradiol. PMID:18958632
STEAPs may represent novel markers of mesenchymal stem cells in man as well as mice. PMID:19196137