Home
Product
Protein
Recombinant Proteins
Recombinant Human Mas-related G-protein coupled receptor member X1 (MRGPRX1), partial

Recombinant Human Mas-related G-protein coupled receptor member X1 (MRGPRX1), partial

CSB-EP822250HU1

Rate （N/A）
Review （0）

Size:

20ug100ug1mg

US$306

Quantity:

Express system: E.coli

Species: Homo sapiens (Human)

Tag Info: C-terminal 6xHis-tagged

Send an Inquiry

Start an on-line Chat

Orders can only be placed from within the U.S.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

MRGPRX1

Uniprot NO.

Q96LB2

Research Area

Neuroscience

Alternative Names

Sensory neuron-specific G-protein coupled receptor 3/4

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

276-322aa

Target Protein Sequence

GSFRQRQNRQNLKLVLQRALQDASEVDEGGGQLPEEILELSGSRLEQ

Mol. Weight

12.2 kDa

Protein Length

Partial

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.83.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function

Orphan receptor. Probably involved in the function of nociceptive neurons. May regulate nociceptor function and/or development, including the sensation or modulation of pain. Potently activated by enkephalins including BAM22 (bovine adrenal medulla peptide 22) and BAM (8-22)(PubMed:26582731). BAM22 is the most potent compound and evoked a large and dose-dependent release of intracellular calcium in stably transfected cells. G(alpha)q proteins are involved in the calcium-signaling pathway. Activated by the antimalarial drug, chloroquine. May mediate chloroquine-induced itch, in a histamine-independent manner.

Gene References into Functions

MRGPRX1 is a promising target for pain inhibition, a humanized mouse model expressing this receptor has been described. PMID:28223516
Der p1 also induced the release of IL-6 from heterologous cells expressing MRGPRX1. In summary, activation of Mrgprs by the allergen Der p1 may contribute to inflammation. PMID:28768771
analysis of the functional interactions between MRGPR-X1 and TRPV1 PMID:23074220

Hide All

Subcellular Location

Cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor 1 family, Mas subfamily

Tissue Specificity

Uniquely localized in a subset of small dorsal root and trigeminal sensory neurons.

Database Links

HGNC: 17962

UNIGENE: Hs.711459

KEGG: hsa:259249

STRING: 9606.ENSP00000305766