Recombinant Human Mannose-binding protein C (MBL2)

Code: CSB-YP013540HUa4
Size:
20ug
20ug100ug1mg
US$250
Quantity:
Express system: Yeast
Species: Homo sapiens (Human)
Tag Info: N-terminal 6xHis-sumostar-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human MBL2 protein
Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
MBL2
Uniprot NO.
Research Area
Immunology
Alternative Names
MBP-C;Collectin-1;MBP1;Mannan-binding protein;Mannose-binding lectin
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
21-248aa
Target Protein Sequence
ETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKGEPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMARIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKEEAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSHLAVCEFPI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
37.1 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-sumostar-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Calcium-dependent lectin involved in innate immune defense. Binds mannose, fucose and N-acetylglucosamine on different microorganisms and activates the lectin complement pathway. Binds to late apoptotic cells, as well as to apoptotic blebs and to necrotic cells, but not to early apoptotic cells, facilitating their uptake by macrophages. May bind DNA.
Gene References into Functions
  1. These findings suggest that high activity of the classical complement pathway, and MBL deficiency, might be associated with an increased odds of unprovoked venous thromboembolism, independent of activation of Tissue Factor-induced coagulation. PMID:30015228
  2. he carrying of MBL2 exon 1 codon 54 variant allele (B) was shown to be a risk factor for Recurrent vulvovaginal candidiasis in childbearing women. PMID:29850562
  3. Positive correlation of MBL levels with anti-ds DNA titers in systemic lupus erythematosus suggest that its values vary with activity and could be a potential biomarker of the disease. PMID:29314753
  4. The -221G>C polymorphism of MBL2, the -159C>T polymorphism of CD14 and the TNF-857 polymorphism of TNF-a are risk factors for spinal spinal tuberculosis (TB) and may be involved in the development of spinal TB in the Chinese population. These factors are indicators of susceptibility to spinal TB and require clinical attention. PMID:29298876
  5. MBL2 protein blood level was significantly reduced in the hepatocellular carcinoma patients.The association in MBL2 polymorphisms and the risk of hepatocellular carcinoma. PMID:27557564
  6. Results suggested the involvement of MBL2 (rs1800450) polymorphism and its protein in rheumatic heart disease pathogenesis. PMID:29653582
  7. MBL deficiency was significantly more frequent in the juvenile idiopathic arthritis Yersinia-reactive antibodies-positive group than in patients without Yersinia-reactive antibodies or in controls PMID:28405017
  8. it can be concluded that molecular analysis of MBL rs1800450 AA genotype and TNF-alpha rs1800620 AA genotype is important in the early detection and treatment of T2DM with H. pylori cagA(+) infection. PMID:29053425
  9. The results suggest that MBL deficiency and the presence of MBL2 gene polymorphisms that lead to MBL deficiency are risk factors for the occurrence of miscarriage in patients with RA. PMID:28898115
  10. These results suggest that the MBL2 gene Codon 54 and TNF-alpha gene G308A polymorphisms are not associated with an increased risk for development of tuberculosis in our patients. PMID:28189510
  11. Studies results provide evidence that Crohn's disease patients have an impairment in mannose-binding lectin-mannose-associated serine protease functional activity and that this defect is associated with mannose-binding lectin 2 and NOD2 variants. PMID:27404661
  12. Our data do not support a possible role for MBL2 polymorphisms in the pathogenesis and in the clinical manifestations of rheumatic fever. PMID:28576308
  13. The reduced expression of functional MBL secondary to having MBL2 variants may partially mediate the increased susceptibility to TB risk. PMID:27812036
  14. MBL2 rs1800450 and rs1800451 polymorphisms play a protective role in TB infection and reinforce their critical significance as a potential genetic marker for TB resistance. PMID:27876780
  15. genetic variants facilitate extended periodontal inflammation and destruction by Aggregatibacter actinomycetemcomitans PMID:27624657
  16. MBL2 exon 1 polymorphic variants were found only in codon 54, and the allele frequencies did not differ significantly between the control and disease groups PMID:28558668
  17. These results indicated that polymorphisms in MBL2 gene may influence susceptibility, progression and prognosis of HBV-related liver diseases. PMID:26857650
  18. The article data indicate that rs11003125 in the MBL2 (Mannose Binding Lectin 2) gene was shown to be associated with a high prevalence of caries in our cohort, and 2 haplotypes are also involved in the increased susceptibility to dental caries. PMID:27894112
  19. the findings of the current study obtained on mother and children from Zambia evidence lack of association between MBL2 functional polymorphisms and HIV-1 mother-to-child transmission PMID:26740328
  20. Mannose-binding lectin levels are largely genetically determined. This relationship was preserved in children during critical illness, despite the effect of large-volume fluid administration on mannose-binding lectin levels. Mannose-binding lectin levels had no association with infection status at admission, or with progression from systemic inflammatory response syndrome to sepsis or septic shock. PMID:27820718
  21. Low MBL levels are associated with a higher risk for future cardiac events and cardiovascular events. PMID:27495980
  22. results showed that despite MBL2 gene polymorphisms being associated with the protein plasma levels, the polymorphisms were not enough to predict the development of heart disease, regardless of infection with both species of Chlamydia. PMID:27982280
  23. MBL2 polymorphisms are associated with higher incidence of development of coronary in-stent restenosis. PMID:28056798
  24. MBL2 gene exon1 polymorphisms are associated with increased risk of high-risk HPV infection and cervical cancer development among Caucasians (Meta-Analysis) PMID:27619685
  25. these data support the concept that rhMBL may serve a protective innate host response and a critical biological response modifier function by limiting AM inflammation, oxidative injury, and AM apoptosis, which may allow effective IAV clearance while limiting collateral damage to vital organs, such as the lungs. PMID:24399838
  26. In a large cohort of VLBWI MBL2 deficiency had no major impact on infection risk unless children were born between 32 0/7 and 36 6/7 weeks of gestation PMID:28558032
  27. The results suggest that the mutations in exon 1 of the MBL2 gene do not contribute directly to the clinical and laboratory features of HCV and HBV infections, but further studies should be performed to confirm whether the wild AA genotype has indirect effect on disease progression. PMID:28408790
  28. binding of dengue virus NS1 to MBL protects dengue virus against mannose-binding lectin-mediated neutralization by the lectin pathway of complement activation PMID:27798151
  29. study provides evidence for an important role for the lectin pathway in the inflammatory response induced by cholesterol crystals (CC) and emphasize the role of ficolin-2 and MBL in the CC-mediated inflammation occurring during atherosclerotic plaque development PMID:27183610
  30. In our meta-analysis, no significant association was found between MBL2 codon 54 A/B, -550 H/L, or -221 X/Y gene polymorphisms and the risk of asthma under 5 genetic models PMID:27590640
  31. MBL2 genotype association with meningococcal disease was not statistically significant. PMID:27351742
  32. The SNP genotypes of MBL2 influence the plasma levels of MBL. However, there is a wide range in MBL levels for a specific genotype of MBL2 during pregnancy indicating that a low second-trimester plasma MBL level is not a marker for the development of preterm birth. PMID:27124763
  33. We have identified two single-nucleotide polymorphisms in two immune-related genes (MBL2 and CD95) that have an association with severe and potentially life-threatening infection following doxorubicin and cyclophosphamide therapy for breast cancer. PMID:27940354
  34. this study shows that collectin may aid clearance of influenza A virus by promoting monocyte uptake of the virus, while reducing viral replication and virus-induced TNF-a responses in these cells PMID:27856789
  35. findings suggest that complement activation mediated by MBL contributes to the pathogenesis and also severity of Multiple sclerosis, Myasthenia gravis, and Guillain-Barre Syndrome . PMID:27424141
  36. Studied the relationship between polymorphisms in MBL, TLR1, TLR2 and TLR6 encoding genes and stimulated IFN-gamma and IL-12 ex vivo production in BCG osteitis survivors. Found that variant genotypes of the MBL2 gene (if homozygous) and variant genotypes of the TLR2 gene (only heterozygotes present) are associated with low IFN-gamma production. PMID:27755461
  37. this study shows that MBL2 polymorphisms is not a major risk factor for community-acquired pneumonia in general, but patients with genotypes corresponding with high serum MBL levels are at risk for atypical pneumonia PMID:28032346
  38. MBL-deficient individuals with additional lectin pathway pattern recognition molecular defects may be at risk to morbidity. PMID:26795763
  39. MBL2 polymorphisms were associated with an increased and TLR7 polymorphisms with a decreased risk of rhinovirus-associated acute otitis media. PMID:28403045
  40. MBL2 rs11003123 polymorphism may be a marker for the risk of hepatocellular carcinoma occurrence in patients with HBV-related cirrhosis in the Chinese population. PMID:27298104
  41. this study shows that MBL levels may be linked with the occurrence of spondyloarthritis in Brazilian patients PMID:27911110
  42. Low baseline MBL levels were correlated with high risk of gram-negative bacteremia; however, no significant correlation was shown in the follow-up. PMID:26377840
  43. These results indicate that the mycobacterial antigen 85 complex is a target for ficolins and mannose-binding lectin. PMID:27141819
  44. In type 1 diabetic patient, evaluated serum levels of MBL can be seen as an independent marker of diabetic nephropathy even after correcting for possible confounding factors. PMID:26212019
  45. association between C + 4T (P/Q) gene polymorphism and oropharyngeal tularemia PMID:27223255
  46. this study shoes that Brazilian patients carrying genotypes or haplotypes of low production of MBL would be more susceptible to dengue haemorrhagic fever PMID:27180198
  47. Low MBL serum levels and deficient MBL2 diplotypes were associated with a higher incidence of acute cellular rejection during the first year after kidney transplantation. PMID:26924055
  48. this study shows the role of MBL2 polymorphisms in hepatitis C infection susceptibility in Italy PMID:27136459
  49. Preterm infants who had low levels of MBL at admission are exposed to an increased risk of adverse neurological outcomes. PMID:26153116
  50. Variant A allele in MBL2 gene rs1800450 polymorphism might increase the risk of sepsis via decrease the MBL serum level PMID:26823854

Show More

Hide All

Subcellular Location
Secreted.
Tissue Specificity
Plasma protein produced mainly in the liver.
Database Links

HGNC: 6922

UNIGENE: Hs.499674

KEGG: hsa:4153

STRING: 9606.ENSP00000363079

OMIM: 154545

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products