Abbreviation
Recombinant Human MIF protein (Active)
Purity
Greater than 85% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized MIF at 2 μg/ml can bind Anti- MIF Rabbit Monoclonal Antibody(CSB-RA146975A0HU), the EC50 is 49.61-69.45 ng/ml.
Alternative Names
(MIF)(Glycosylation-inhibiting factor)(GIF)(L-dopachrome isomerase)(L-dopachrome tautomerase)(Phenylpyruvate tautomerase)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
2-115aa
Target Protein Sequence
PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal hFc1-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized MIF at 2 μg/ml can bind Anti- MIF Rabbit Monoclonal Antibody(CSB-RA146975A0HU), the EC50 is 49.61-69.45 ng/ml.
Description
Macrophage migration inhibitory factor (MIF) is a pleiotropic cytokine that drives pro-inflammatory signaling and tumor microenvironment remodeling, making it a critical target in cancer immunology research. This recombinant human MIF, covering the full-length mature sequence (aa 2–115) with a C-terminal hFc1 tag, demonstrates confirmed binding activity in functional ELISA, where immobilized protein at 2 μg/ml binds anti-MIF rabbit monoclonal antibody with an EC50 of 49.61–69.45 ng/ml — a result that supports use as a coating antigen for antibody development and validation, or as a positive control in MIF detection assays. Endotoxin levels below 1.0 EU/μg, determined by LAL method, minimize LPS-driven artifacts in immune cell-based experiments such as macrophage activation, NF-κB or MAPK signaling pathway studies, and in vivo tumor biology models. Mammalian cell expression preserves native folding and post-translational modifications, while purity exceeding 85% by SDS-PAGE satisfies the quality thresholds commonly required for these functional applications.