Recombinant Human Lysophosphatidic acid receptor 3 (LPAR3), partial

Code: CSB-EP013049HU
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$306
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
LPAR3
Uniprot NO.
Research Area
Cardiovascular
Alternative Names
Lysophosphatidic acid receptor Edg-7
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
298-353aa
Target Protein Sequence
EDMYGTMKKMICCFSQENPERRPSRIPSTVLSRSDTGSQYIEDSISQGAVCNKSTS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
11.3 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
13-23 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for lysophosphatidic acid (LPA), a mediator of diverse cellular activities. May play a role in the development of ovarian cancer. Seems to be coupled to the G(i)/G(o) and G(q) families of heteromeric G proteins.
Gene References into Functions
  1. Using pharmacological activators and shRNA knockdown experiments, we demonstrate that activation of LPA3 inhibits megakaryopoiesis in human HSCs. In addition, pharmacological activation of LPA3 suppressed thrombopoiesis in zebrafish. PMID:29239275
  2. The results indicate that LPA2 and LPA3 receptors play opposing roles during red blood cells differentiation. PMID:27244685
  3. myeloma cells stimulate mesenchymal stem cells (MSCs to produce autotaxin, an indispensable enzyme for the biosynthesis of lysophosphatidic acid, and LPA receptor 1 (LPA1) and 3 (LPA3) transduce opposite signals to MSCs to determine the fate of MSCs. PMID:27641212
  4. Expression profiles reveal LPAR3 (lysophosphatidic acid receptor 3) as a mediator for mitotic phosphorylation-driven pancreatic cell motility and invasion. Together, this work identifies YAP as a novel regulator of pancreatic cancer cell motility, invasion and metastasis. PMID:26440309
  5. These data indicated that the expression of LPA receptor 3 was increased in human triple-negative breast cancers and is associated with tumor metastatic ability. PMID:25209561
  6. Suggest that LPA2 and LPA3 may function as a molecular switch and play opposing roles during megakaryopoiesis of K562 cells. PMID:25463482
  7. The results demonstrate LPA-stimulated migration in oral carcinoma cells through LPAR3, mediated further by PKC, which acts either in concert with or independently of EGFR transactivation PMID:24928086
  8. LPA3 mRNA is clearly expressed in human PANC-1 tumor cells. PMID:24061591
  9. Lysophosphatidic acid (LPA) increased hepatocellular carcinoma cells cell invasion, which was LPA-receptor dependent. PMID:23569130
  10. in the normal human menstrual cycle, lysophosphatidic acid receptor 3 messenger RNA and protein expression change, indicating that this gene may be related to the function of the endometrium. PMID:22872026
  11. The results indicated that LPA(3) acts as a positive regulator of cell motility and invasion in sarcoma cells, suggesting that LPA signaling pathway via LPA(3) may be involved in the progression of sarcoma cells. PMID:23167620
  12. High LPAR3 expression is associated with aggressiveness of breast carcinoma. PMID:22922883
  13. LPA3 Receptor act as a negative regulator on cell motile and invasive abilities of colon cancer. PMID:22763559
  14. found that LPA receptor 2/3-mediated IL-8 expression occurs through Gi/PI3K/AKT, Gi/PKC and IkappaB/NF-kappaB signaling PMID:21964883
  15. study found that LPS induces both ATX and LPA3 expression in THP-1 cells; the PKR and SPK1-mediated pathways are involved in both ATX and LPA3 induction, resulting in the coordinate up-regulation of these two genes PMID:22314276
  16. Mutation in LPA3 gene indicate that the alterations in LPA receptor gene may play some role in pathogenesis in human osteosarcoma cells. PMID:21116120
  17. Data show that CLL cells express LPA receptors LPA(1-5) and VEGF receptors, and the plasma levels of VEGF are elevated in CLL patients. PMID:19860625
  18. show that human microglia express LPA receptor subtypes LPA(1), LPA(2), and LPA(3) on mRNA and protein level. LPA activation of C13NJ cells induced Rho and extracellular signal-regulated kinase activation and enhanced cellular ATP production. PMID:19899077
  19. demonstrate that two biological fluids, blood plasma and seminal plasma, differentially activate LPA receptors PMID:12123830
  20. results suggested that lysophosphatidic acid (LPA) receptors LPA(2) and LPA(3) may be involved in VEGF expression mediated by LPA signals in human ovarian oncogenesis PMID:12668280
  21. data suggest that endothelial differentiation gene EDG-7 regulates Lysophosphatidic acid(LPA)-mediated mesangial cell proliferation and suggest that EDG-7 and EDG-2 LPA receptors play a diverse role in mesangial cell proliferation PMID:15292052
  22. expression of LPA-induced inflammatory response genes is mediated by LPA1 and LPA3 PMID:17923111
  23. Lysophosphatidic acid receptor 3 may contribute to the pathogenesis of rheumatoid arthritis through the modulation of fibroblast-like synoviocyte migration and cytokine production. PMID:18006645
  24. Lysophosphatidic acid might regulate VEGF-C and lymphatic marker expression in endothelial cells, which contributes to endothelial cell tube formation in vitro and in vivo, thus facilitating endothelial cell participation lymphangiogenesis. PMID:18627789
  25. Expression of LPA3 during ovarian carcinogenesis contributes to ovarian cancer aggressiveness, suggesting that the targeting of LPA production and action may have potential for the treatment of ovarian cancer. PMID:19001604
  26. Switching of LPA receptor expression from LPA3 to LPA1, may be involved in prostate cancer progression and/or androgen independence PMID:19025891
  27. LPA(1) receptor, LPA(2) and LPA(3) receptors-induced VASP phosphorylation is a critical mediator of tumor cell migration initiation PMID:19081821
  28. LPA-stimulated cell growth is mediated by distinct but overlapping receptors and signaling pathways in these two model ovarian cancer cell lines. PMID:19420982

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Most abundantly expressed in prostate, testes, pancreas, and heart, with moderate levels in lung and ovary. No detectable expression in brain, placenta, liver, skeletal muscle, kidney, spleen, thymus, small intestine, colon, or peripheral blood leukocytes
Database Links

HGNC: 14298

UNIGENE: Hs.527909

KEGG: hsa:23566

STRING: 9606.ENSP00000359643

OMIM: 605106

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products