| Code | |
| MSDS | |
| Size | Pls inquire |
| Source | |
| Conjugate | |
| Have Questions? | Leave a Message or Start an on-line Chat |
Please provide the following information regarding this protein (all expression systems):
1.Sequence
2.Tag type
3.Tag position
4.Pricing, sizes and formats
***Can this protein be used as a positive control for IP/western blot?
KWKLQLHELTKLPAFVRVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEW
Email: support@cusabio.com
Distributors Worldwide