Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
JmjC domain-containing histone demethylation protein 2B
Jumonji domain-containing protein 1B
Nuclear protein 5qNCA
Species
Homo sapiens (Human)
Expression Region
1498-1721aa
Target Protein Sequence
MPTRFEDLMENLPLPEYTKRDGRLNLASRLPSYFVRPDLGPKMYNAYGLITAEDRRVGTTNLHLDVSDAVNVMVYVGIPIGEGAHDEEVLKTIDEGDADEVTKQRIHDGKEKPGALWHIYAAKDAEKIRELLRKVGEEQGQENPPDHDPIHDQSWYLDQTLRKRLYEEYGVQGWAIVQFLGDAVFIPAGAPHQVHNLYSCIKVAEDFVSPEHVKHCFRLTQEFR
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description
The region for expressing recombinant Human KDM3B contains amino acids 1498-1721. The calculated molecular weight for this KDM3B protein is 45.6 kDa. Expression of this KDM3B protein is conducted in e.coli. Fusion of the N-terminal 10xHis-SUMO tag and C-terminal Myc tag into the KDM3B encoding gene fragment was conducted, allowing for easier detection and purification of the KDM3B protein in subsequent stages.
Human lysine-specific demethylase 3B (KDM3B) is an epigenetic regulator that demethylates histones, specifically removing methyl groups from lysine 9 on histone H3. Its main function involves modulating chromatin structure, influencing gene expression, and participating in cellular processes like DNA repair and cell cycle regulation. In cancer research, KDM3B is implicated in tumorigenesis and metastasis. KDM3B may serve as a potential therapeutic target in cancer treatment. In stem cell biology, KDM3B influences cell fate decisions. Investigating KDM3B provides insights into epigenetic regulation, chromatin dynamics, and disease mechanisms. Understanding its multifaceted functions contributes to advancements in epigenetics, cancer biology, and stem cell research.
