Recombinant Human Low affinity immunoglobulin gamma Fc region receptor II-b (FCGR2B), partial

Code: CSB-MP008541HU1
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$500
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: C-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
FCGR2B
Uniprot NO.
Research Area
Immunology
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
46-217aa
Target Protein Sequence
APPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
21.6 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
18-28 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Receptor for the Fc region of complexed or aggregated immunoglobulins gamma. Low affinity receptor. Involved in a variety of effector and regulatory functions such as phagocytosis of immune complexes and modulation of antibody production by B-cells. Binding to this receptor results in down-modulation of previous state of cell activation triggered via antigen receptors on B-cells (BCR), T-cells (TCR) or via another Fc receptor. Isoform IIB1 fails to mediate endocytosis or phagocytosis. Isoform IIB2 does not trigger phagocytosis.
Gene References into Functions
  1. Data show that patients with low FcgammaRIIb (CD32b) expression required therapy earlier than those with high FcgammaRIIb expression. PMID:28372509
  2. This first genome-wide association approach for cyclophosphamide response in lupus nephritis patients yielded a robust profile of genetic associations including large-effect SNP in the FCGR2B-FCRLA locus, which may provide better insights to cyclophosphamide metabolism and efficacy. PMID:26980576
  3. Trans-inhibition of activation and proliferation signals by Fc receptors in mast cells and basophils PMID:27999175
  4. These results suggest that abnormal B cell subset distribution and decreased CD32b expression on DN memory cells might be involved in the pathogenesis of Hashimoto's thyroiditis. PMID:27832986
  5. the single-residue polymorphism T232 enforces the inclination of the transmembrane domain and thereby reduces the lateral mobility and inhibitory functions of FcgammaRIIB. PMID:27799621
  6. results indicate that FcgammaRIIB is not uniquely able to promote membrane recruitment of SHIP, but rather modulates its function via formation of distinct signaling complexes. Membrane recruitment of SHIP via Syk-dependent mechanisms may be an important factor modulating immunoreceptor signaling. PMID:27456487
  7. Fc gamma receptor IIb was significantly elevated in abdominal aortic aneurysm (AAA) tissues compared to normal aortas. Fc gamma receptor IIb may be involved in the pathogenesis of AAA by regulation of inflammatory reactions. PMID:28223220
  8. this study shows that decreased FcgRIIb expression on monocytes may contribute to the development of coronary artery lesions in patients with Kawasaki disease PMID:28147297
  9. Data indicate that IgG2 Y296F variant showed decreased binding for FcgammaRIIb. PMID:23628091
  10. LPS activation of TLR4 significantly increased MARCH3 expression and that siRNA against MARCH3 prevented the decrease in FcgammaRIIb following LPS treatment. PMID:26694610
  11. a rare FCGR2B null-variant allele was found, in which a polymorphic stop codon of FCGR2C is introduced into one FCGR2B gene PMID:26133275
  12. FcgammaRIIB requires Btk and p38 MAPK to mediate antigen-independent inhibition in human B cells. PMID:26475492
  13. The FCGR2B variant leads to reduced serum IL-6, later disease onset and reduced need for biological treatment, but does not seem to aggravate RA. The TM region variant is associated with a lower activation state of the Tregs and naive and memory B cells. PMID:25630523
  14. FcgammaRIIB rs12117530 polymorphism is associated with disease risk and clinical manifestations of Systemic Lupus Erythematosus in Koreans. PMID:26084639
  15. increased serum levels involved in aberrant immune responses in systemic sclerosis PMID:25346304
  16. FcgIIb on GM-CSF macrophages has a role in controlling immune complex-mediated inhibition of inflammatory signals PMID:25340460
  17. none of the three functional polymorphisms in FcgammaR genes explored here, the FCGR3A F158V and FCGR2B I232T nsSNPs and the VNTR in FCGRT, showed an association with the response to TNFi in patients with rheumatoid arthritis PMID:25823782
  18. FCGR2B inhibitory gene may be predictive of adjuvant trastuzumab benefit in HER2+ breast cancer patients. PMID:24989892
  19. FcgammaRIIB prevents inflammatory type I IFN production from plasmacytoid dendritic cells during a viral memory response. PMID:25821224
  20. The study provides evidence for FcgammaRs, especially FcgammaRIIB, being involved in the pathogenesis of Hashimoto's thyroiditis. PMID:25670392
  21. Variants in FcgRIIB may play a role in the development of Lupus through their roles in apoptosis or debris clearance. PMID:25034154
  22. cross-linking by FcgammaRIIb is critical for the superagonist activity of TGN1412 after high-density preculture PMID:25395427
  23. Data indicate that inhibition of phagocytosis by IVIg is independent of IgG-Fc-sialylation and does not require an increase of fc-gamma-RIIb (FcgammaRIIb) expression. PMID:25352126
  24. Suppression of innate and adaptive B cell activation pathways by antibody coengagement of FcgammaRIIb and CD19. PMID:24828435
  25. Data indicate that the lentiviral expression vector for FcgammaRIIB was successfully prepared and its expression in HT-1080 cells is controllable via the alterations of doxycycline (Dox) concentration. PMID:24909272
  26. found no significant difference in pretransplant panel reactive antibodies, acute rejection at 1-year nor in 10-year transplant or patient survival in individuals with differing FcgammaRIIB-I/T232 genotype PMID:25022320
  27. the decreased FcgammaRIIb1 translocation to lipid rafts as well as for the reduced tyrosine-phosphorylated FcgammaRIIb1 PMID:24405601
  28. This inhibitory function of FcgammaRIIB in impairing the spatial-temporal colocalization of BCR and CD19 microclusters in the B cell immunological synapse may help explain the hyper-reactive features of systemic lupus erythematosus PMID:24790152
  29. these data demonstrate that CD19 and CD32b differentially inhibit B cell expansion and plasma cell differentiation, depending on the nature of the activating stimuli, when engaged with monospecific Abs. PMID:24442430
  30. T cells mount rapid TGN1412 responses, which are massively boosted by FcgammaR crosslinking, in particular by CD32-expressing B cells. These results qualify HDC-PBMCs as a valuable in vitro test system for the analysis of complex mAb functions. PMID:24470499
  31. FCGR2B and FCGR1B augment the internalization of monoclonal antibodies on the surface of B cells. PMID:24227819
  32. memory CD8 T cells intrinsically express a functional FcgammaRIIB, permitting Ag-Ab complexes to regulate secondary CD8 T cell responses. PMID:24285839
  33. Lower expression of FCGRIIB is likely involved in the etiology of ITP. HP infection is correlated with decreased expression of FCGRIIB. PMID:23054650
  34. Data suggest that Fcgamma receptor IIB (FcgammaRIIB) 232I/T polymorphisms may play an important role in susceptibility to H pylori-infected immune thrombocytopenia (ITP) and in platelet responses after H pylori eradication in ITP patients. PMID:24030263
  35. The aim of the study was to associate multiple polymorphisms within FCGR gene locus with IgA nephropathy in a large Chinese cohort. PMID:23593433
  36. FcgammaRIIb has an aberrant, but essential, role in amyloid beta-mediated neuronal dysfunction. PMID:23921129
  37. Our data revealed that downregulation of CD32B on B cells from patients with rheumatoid arthritis is mediated by CD40-CD40L interactions PMID:23686494
  38. Maternal FcgammaRIIB-nt645+25A/G polymorphism and subgingival DNA level of A. actinomycetemcomitans were significantly associated with the prevalence of preeclampsia in a limited number of Japanese women. PMID:22594540
  39. Compared with the mouse system, human monomeric IgG subclasses have an even smaller affinity for low-affinity FcgammaRIIA, FcgammaRIIB, and FcgammaRIIIA, making it difficult to obtain exact data. PMID:23509345
  40. FcgammaRIIb on myeloid cells of bone marrow chimeric mice plays a major role in their protection from nephrotoxic nephritis. PMID:23203925
  41. We conclude that FCGR3B deletion juxtaposes the 5'-regulatory sequences of FCGR2C with the coding sequence of FCGR2B. PMID:23261299
  42. FcgammaRIIB might play an important role in the central nervous system infection by Cryptococcus in HIV-uninfected individuals. PMID:22879986
  43. CRP antagonism of eNOS is mediated by coupling of FcgammaRI to FcgammaRIIB by Src kinase and activation of inositol 5'-phosphatase 1, and consistent with this mechanism, both FcgammaRI and FcgammaRIIB are required for CRP to blunt endothelial repair in vivo. PMID:21940940
  44. activation of FasL is dependent on glucuronoxylomannan interaction with FcgammaRIIB;results highlight a fast track to FasL up-regulation via FcgammaRIIB and assign to this receptor an anti-inflammatory role that also accounts for induced peripheral tolerance PMID:21605112
  45. These findings suggest that FcgammaRIIB-nt645+25AA carriers are more likely to experience preterm birth than FcgammaRIIB-nt645+25AG and GG carriers. Also, women with FcgammaRIIB-nt645+25G exhibited a greater tendency to have periodontitis than those with nt645+25A. PMID:21338356
  46. Peritoneal B1 cells express the highest levels of transgenic FcgammaRIIb among B cell subsets. PMID:22516957
  47. FCGR2B rs10917661 may be a novel Single-nucleotide polymorphism involved in ankylosing spondylitis genetic predisposition in the Han Chinese population PMID:22416796
  48. The higher expression levels of FcgammaRIIb in subjects with the FcgammaRIIB-nt645+25AA genotype may induce a lower level of production of IgG against P. gingivalis and therefore more severe periodontitis. PMID:21906057
  49. Data suggest that rituximab induces apoptosis of malignant B lymphocytes by stimulating FcgammaRIIB receptors and inhibiting Kv1.3 channels. PMID:22192444
  50. The R allele of the FcgammaRIIa polymorphism is associated with impaired endothelium-dependent vasodilatation and reduced NO activity during endothelial cell stimulation PMID:21813128

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Is the most broadly distributed Fc-gamma-receptor. Expressed in monocyte, neutrophils, macrophages, basophils, eosinophils, Langerhans cells, B-cells, platelets cells and placenta (endothelial cells). Not detected in natural killer cells.
Database Links

HGNC: 3618

UNIGENE: Hs.654395

KEGG: hsa:2213

STRING: 9606.ENSP00000351497

OMIM: 152700

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products