Recombinant Human Low affinity immunoglobulin epsilon Fc receptor (FCER2), partial

In Stock
Code: CSB-EP008534HU1a0
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$224
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: N-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
FCER2
Uniprot NO.
Research Area
Immunology
Alternative Names
(BLAST-2)(C-type lectin domain family 4 member J)(Fc-epsilon-RII)(Immunoglobulin E-binding factor)(Lymphocyte IgE receptor)(CD antigen CD23)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
48-248aa
Target Protein Sequence
DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPG
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
27.3 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Low-affinity receptor for immunoglobulin E (IgE) and CR2/CD21. Has essential roles in the regulation of IgE production and in the differentiation of B-cells (it is a B-cell-specific antigen).
Gene References into Functions
  1. Report a variant of t(14;18) negative nodal diffuse follicular lymphoma with CD23 expression, 1p36/TNFRSF14 abnormalities, and STAT6 mutations. PMID:26965583
  2. High CD23 expression is associated with B-cell Lymphoma. PMID:28108506
  3. found a higher frequency of LIN1(-) CCR3(+) eosinophils, and decreased expression of CD23 and CD62L receptors in eosinophils of AD patients PMID:27406841
  4. there is a high CD23a/CD23b ratio of chronic lymphocytic leukemia cells, which demonstrates that in a subset of CLL cases, low CD23 expression together with high CD20 and CD38 expressions may serve as a surrogate for trisomy 12 PMID:26119874
  5. Binding of CTLA4Fcepsilon to FcepsilonRII/CD23 appeared stronger than that of IgE PMID:26801967
  6. Human and murine P2X7 activation induces the rapid shedding of CD23 from B cells, with a potential role for ADAM10 in this process. PMID:25155463
  7. Elevated serum sCD23 is associated with increased risk of non-Hodgkin lymphoma. PMID:25567136
  8. Data suggest that the protective immune response involving CD23-IgE-mediated nitric oxide release in cutaneous leishmaniasis (LCL). PMID:25802003
  9. Crystal structure of the CD23-Fc3-4 complex with different molecular-packing constraints. PMID:24598915
  10. data indicate that the studied FCER2 variations are strongly associated with asthma susceptibility and might be risk factor among north Indian asthmatic children PMID:24102092
  11. we have demonstrated that PU.1, GATA1, and GATA2 are involved in the expression of FcepsilonRI in a human mast cell line and primary human mast cells using siRNA with high transfection efficiency, and by ChIP assay. PMID:24639354
  12. CD23b-R62W-expressing human B cells bind IgE with greater affinity than wild-type cells and display differences in kinetics of CD23-mediated ERK1/2 activation PMID:24010859
  13. The interplay of free IgE with IgE-allergen immune complexes of different sizes and composition with CD23 binding represents a mechanism for the modulation of CD23-mediated immune responses. PMID:23229638
  14. Data indicate that the interaction of IgE with CD23 on B-cells regulates IgE production. PMID:23933509
  15. Results suggest that binding of Ca(2+) brings an extra degree of modulation to CD23 function. PMID:23775083
  16. The results are consistent with the suppression of parasite and allergen-specific IgE levels by sCD23. PMID:23689700
  17. Data indicate that upon sialylation, the affinities for Fcgamma receptors are reduced, whereas those for alternative cellular receptors, such as dendritic cell-specific intercellular adhesion molecule-3-grabbing nonintegrin (DC-SIGN)/CD23, are increased. PMID:23697368
  18. Results support the complex model of CD23 induction by Epstein-Barr virus (EBV). PMID:23583387
  19. Downregulation of CD23 attenuated AIMP1-induced TNF-alpha secretion and AIMP1 binding. PMID:22767513
  20. All subtypes of juvenile arthritis have reduced circulating levels of sCD21 and sCD23. PMID:21328056
  21. CD23 and FcepsilonRI interaction sites are at opposite ends of the Cepsilon3 domain of IgE, but that receptor binding is mutually inhibitory, mediated by an allosteric mechanism PMID:22815482
  22. Structural comparisons with both free IgE-Fc and its FcepsilonRI complex reveal not only that the conformational changes in IgE-Fc required for CD23 binding are incompatible with FcepsilonRI binding, but also that the converse is true. PMID:22802656
  23. Binding of sCD23-derived peptides to av integrins and their biological activities are tolerant of some substitution in the recognition motif. PMID:22560905
  24. Findings suggest that patients with t(11;14)(+)/CD23(+) plasma cell myelomas (PCM) present with lower platelet counts and may have a shorter overall survival than those with t(11;14)(+)/CD23(-) PCM. PMID:21724429
  25. Variation at GLCCI1 and FCER2 could lead personalized asthma treatment. PMID:22304573
  26. Soluble CD23 promoted the release of cytokines from the THP-1 model cell line. In both model cell lines and primary tissue, cytokine release was more pronounced in immature monocyte cells than in mature cells. PMID:22348662
  27. mIgE & mCD21 cooperate in sCD23-mediated positive regulation of IgE synthesis on committed B cells. Feedback regulation may occur when the secreted-IgE level is big enough to allow binding to mCD23. This prevents further sCD23 release. PMID:22393152
  28. Transfectants expressing the single nucleotide polymorphism in FCER2 exhibited increased IL-4Ralpha expression after stimulation through CD23 compared with wild-type. PMID:22059556
  29. Our results suggest that the FCER2 T2206C variant might be a useful pharmacogenetic predictor of steroid refractory patients. PMID:21958076
  30. SPR analysis revealed a progressive increment in affinity of soluble fragments for IgE, upon increasing length of CD23 "stalk" domain, exCD23>sCD23>derCD23. PMID:21889131
  31. The association of CD23 and CD30 antigen blood levels with the development of non-Hodgkin lymphoma in HIV patients is reported. PMID:21860351
  32. Report the role of CD23 SNPs in IgE dependent signaling in B-lymphocytes. PMID:21686206
  33. IgE may be considered as immune mediator during antiprotozoal activity of human macrophages through its ability to trigger CD23 signaling. PMID:21526166
  34. show for the first time that CD9 and CD81 act as molecular partners of trimeric FcvarepsilonRI on human antigen-presenting cell PMID:21241315
  35. CD23 and CD19 are important factors that associated with serum total IgE in the pathogenesis of allergic rhinitis. PMID:20359104
  36. CD23-mediated immunoglobulin (Ig)E transcytosis in human airway epithelial cells may play a critical role in initiating and contributing to the perpetuation of airway allergic inflammation. PMID:21307287
  37. A model of CD23-bound IgE-mediated amplification of immunity by B cells is demonstrated in schistosomiasis. PMID:21160045
  38. Data suggest that the CD23-mediated signal transduction pathways in human B cells and human monocytes are different. PMID:20805040
  39. Data indicate that the regions of CD23 responsible for interaction with ligands have been identified and help to explain the structure-function relationships within the CD23 protein. PMID:20831712
  40. CD23 is a useful marker in distinguishing mediastinal diffuse large B-cell lymphoma and classical Hodgkin lymphoma in mediastinal biopsies. PMID:19223373
  41. Interaction of functional FCER2 promoter polymorphism and phenotype-associated haplotypes PMID:19845913
  42. cd23 negativity is rare in typical b-cell CLL; negativity in patients with CD19+/CD5+ is suggestive of mantle cell leukemia PMID:11920534
  43. prognostic significance of soluble CD23 in advanced stages of B-chronic lymphocytic leukemia and its role as an indicator for aggressive or indolent courses of disease. PMID:12002758
  44. a review on the domains and functions of the cd23 receptor PMID:12022472
  45. upstream regions of the CD23a and CD23b isoform coding sequences show distinct sensitivities to agents which induce CD23 protein expression at the plasma membrane PMID:12070780
  46. Investigation of several stimulators to promote CD23a expression on CLL vs. normal B-cells confirmed a different CD23 regulation in B-CLL. CD23a is always predominantly expressed (constant ratio of CD23a:CD23b). PMID:12127553
  47. CD23 expression in chronic lymphocytic leukemia was 53.9 times higher than in mantle-cell llymphoma. PMID:12127555
  48. At term, the percentage of CD21(+) and CD23(+) B cells was comparable to the adult PMID:12149502
  49. promoter is a target for NF-AT transcription factors in B-CLL cells PMID:12379312
  50. The data show that monocyte-derived DC express the P2X7 receptor whose activation opens a cation-selective channel, and which leads to rapid and near complete shedding of CD23. PMID:12456589

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type II membrane protein. Cell membrane; Lipid-anchor. Secreted. Note=Also exists as a soluble excreted form, sCD23.
Database Links

HGNC: 3612

UNIGENE: Hs.465778

KEGG: hsa:2208

STRING: 9606.ENSP00000264072

OMIM: 151445

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products