Home
Product
Protein
Recombinant Proteins
Recombinant Human Killer cell immunoglobulin-like receptor 2DS3 (KIR2DS3), partial

Recombinant Human Killer cell immunoglobulin-like receptor 2DS3 (KIR2DS3), partial

In Stock

Code: CSB-EP613530HUb1

Rate （N/A）
Review （0）

Size:

20μg100μg1mg(1mg*1 or 500ug*2)

US$256

Quantity:

Express system: E.coli

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

KIR2DS3

Uniprot NO.

Q14952

Research Area

Others

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

22-245aa

Target Protein Sequence

HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

31.7 kDa

Protein Length

Extracellular Domain

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.

Gene References into Functions

activating KIR2DS3 was associated with rapid leukocyte engraftment after hematopoietic stem cell transplantation from matched sibling PMID:28993188
Genotypes missing these two inhibitory KIR-HLA combinations in addition to missing activating KIRs 2DS2 and 2DS3 were more common in Vogt-Koyanagi-Harada disease (OR = 1.90, P = 0.002). PMID:27490240
Loss of KIR2DS3 gene is associated with breast cancer. PMID:27631728
genetic polymorphism is associated with childhood acute lymphoblastic leukemia among north Indians PMID:26472014
The genes KIR2DL5, KIR2DS3 and KIR2DS5 were present in a significantly higher proportion of individuals in the asymptomatic control group than in the malaria cases. PMID:24929143
the presence of host genetic risk factors, IL28B-T and KIR2DS3 alleles, resulted in increased odds of treatment failure in these rapid virological response negative patients. PMID:23826153
KIR2DS3 and HLA-class I alleles (-Cw*14 and -Cw*17) may play a role in the pathogenesis of the Vogt-Koyanagi-Harada disease. PMID:22219647
The Natural Killer cell gene KIR2DS3 was significantly increased in patients with chronic hepatitis C virus infection. PMID:21402922
KIR2DS3 is associated with protection against acute myeloid leukemia. PMID:20371915
Positive linkage disequilibrium was seen between KRI2DS2 and KIR2DS3. Positive linkage disequilibrium was seen between KIR3DS1 and KIR2DS3. PMID:12559621
KIR2DS3 is a protective factor for chronic graft-versus-host disease. PMID:17462498
This focuses on the inheritance of KIR2DS3*001 and *002 to clarify their genetic relationship, and will investigate the diversity of haplotypes containing a KIR2DS3 gene. PMID:18480828
Genomic and mRNA sequences support the KIR2DS3*002 gene being a hybrid of KIR2DS3*00103 and KIR2DS5. PMID:18764809
Dramatically reduced surface expression of NK cell receptor KIR2DS3 is attributed to multiple residues throughout the molecule. PMID:19005473
KIR2DS3 incompatibilities increased risk of chronic graft-versus-host disease after allogeneic hematopoietic stem cell transplantation PMID:19500138