Recombinant Human Kallikrein-7 (KLK7), partial

Code
MSDS
Size Pls inquire
Source
Conjugate
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
KLK7
Uniprot NO.
Research Area
Cancer
Alternative Names
Chymotryptic stratum corneum; hK 7; hK7; hSCCE; Kallikrein 7 (chymotryptic stratum corneum); Kallikrein related peptidase 7; Kallikrein-7; Kallikrein7; KLK 7; Klk7; KLK7_HUMAN; Protease serine 6; PRSS 6; PRSS6; SCCE; Serine protease 6; Signal protein; Stratum corneum chymotryptic enzyme
Species
Homo sapiens (Human)
Source
Baculovirus
Expression Region
28-253aa
Target Protein Sequence
DKIIDGAPCARGSHPWQVALLSGNQLHCGGVLVNERWVLTAAHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSMVKKVRLPSRCEPPGTTCTVSGWGTTTSPDVTFPSDLMCVDVKLISPQDCTKVYKDLLENSMLCAGIPDSKKNACNGDSGGPLVCRGTLQGLVSWGTFPCGQPNDPGVYTQVCKFTKWINDTMKKHR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.4kD
Protein Length
Partial
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
May catalyze the degradation of intercellular cohesive structures in the cornified layer of the skin in the continuous shedding of cells from the skin surface. Specific for amino acid residues with aromatic side chains in the P1 position. Cleaves insulin A chain at '14-Tyr-|-Gln-15' and insulin B chain at '6-Leu-|-Cys-7', '16-Tyr-|-Leu-17', '25-Phe-|-Tyr-26' and '26-Tyr-|-Thr-27'. Could play a role in the activation of precursors to inflammatory cytokines.
Gene References into Functions
  1. These results show that aberrant KLK7 expression leads to a switch from proliferative to invasive phenotype, suggesting a potential role of KLK7 in melanoma progression. PMID:28636767
  2. KLK7 is differentially expressed in lesional biopsy specimens from patients with atopic eczema relative to normal skin PMID:28479159
  3. impaired KLK7 secretion from lamellar granules and increased LEKTI expression could underlie the insufficient activation of KLK in atopic dermatitis. PMID:27769847
  4. Epigenetic regulation of KLK7 gene expression in pancreatic and cervical cancer cells PMID:27279059
  5. Korean X-linked ichthyosis patients exhibited unimpaired skin barrier function and frequent association with the KLK7 gene polymorphism, which may differentiate them from Western X-linked ichthyosis patients. PMID:27478344
  6. This report demonstrates that concurrent loss of KLK5 and KLK7 associates with a poor clinical outcome in Squamous-Cell Carcinoma and could therefore serve as prognostic marker in this disease. PMID:26022646
  7. Data demonstrate that elevated levels of KLK6, KLK7 and KLK9 proteins are associated with poor glioblastoma patients survival. PMID:26231762
  8. Our findings suggest that serum KLK7 may be a valuable diagnostic biomarker for cervical cancer, and may help to determine the individual prognosis of these patients. PMID:25182706
  9. KLK6 and KLK7 mRNA and protein overexpression is directly associated with early-stage ovarian tumors. PMID:25477184
  10. Proteolytic cleavage of midkine, CYR61, and tenascin-C govern the pathophysiological roles of KLK7. PMID:26032414
  11. Early-stage oral squamous cell carcinoma and high KLK7 mRNA levels were correlated with the rs10581213(wt/ins + ins/ins) genotypes PMID:23413953
  12. These results demonstrate the aberrant expression of KLK7 in colon cancer cells and tissues and its involvement in cell proliferation in vitro and in vivo. PMID:25153388
  13. Daata indicate that the peptide Abz-NLY( downward arrow)RVE-Q-EDDnp is the best synthetic substrate for Kallikrein-related peptidase 7 (KLK7) [kcat/Km=455 (mMs)(-1)]. PMID:25448018
  14. KLK7 and KLK14 gene expression can be regarded as markers of poor prognosis for colorectal cancer patients with discriminating power between CC and adenoma patients. PMID:23224034
  15. Prochemerin processing protease converts prochemerin into active chemerinF; the activating truncation by the protease may trigger a structural C-terminal rearrangement leading to increased affinity of chemerin to chemokine-like receptor (CMKLR)1. PMID:23495698
  16. High KLK7 expression is associated with pancreatic ductal adenocarcinoma. PMID:22573795
  17. regulation of procaspase-14 maturation during terminal differentiation is a unique two-step process involving KLK7 and an activation intermediate of caspase-14. PMID:22825846
  18. The enhancement of protease activity through increased KLK7 expression by the TH2 cytokines IL-4 and IL-13 might be an important factor for mechanical and chemical epidermal barrier dysfunction in patients with atopic dermatitis. PMID:22521249
  19. Stromal cells can suppress the expression of the KLK7 gene in the epithelial cells in benign prostate hyperplasia. PMID:21548205
  20. Significant co-expression of KLKs 5 and 7 was observed in the same cancer samples. Increased KLK5 expression was a statistically significant independent prognostic factor for DFS and OS of patients PMID:21868565
  21. Both KLK7 (P=0.026) and KLK11 (P<0.001) expressions were decreased in prostate cancer cells compared to normal/benign prostate cells PMID:21520985
  22. KLK7 may play an important role in the activation of MMP-9 in tumors that express high levels of both these proteases PMID:21616098
  23. Our evidence suggests that the AACCins5874 insertion in the 3'untranslated region of the SCCE gene causes an over-expression in COS-7 and HeLa cells but does not have an effect on mRNA stability. PMID:21168996
  24. in the high-KLK7-expression group there was more progressive liver metastasis and more advanced clinical staging compared with the low-KLK7-expression group PMID:20544292
  25. hK7 plays an important role in mediating prostate cancer progression PMID:20944116
  26. Overexpression of kallikrein 7 is associated with cervical neoplasia. PMID:19921697
  27. expression and activity of KLK are under fine control and can be distinctly influenced by variables such as differentiation, calcium, vitamin D, and retinoic acid PMID:20090765
  28. High expression of KLK7 transcript with a long 3'-untranslated region is associated with ovarian cancer PMID:12738725
  29. human kallikrein 7 may have a role in breast carcnoma PMID:14691584
  30. Among all kallikreins measured, detectable levels in cerebrospinal fluid are identified for kallikrein K7. The most notable difference is seen between controls and frontotemperol dementia patients and controls and Alzheimer patients. PMID:14972646
  31. SCCE directly cleaved corneodesmosin and desmocollin 1 but was unable to degrade desmoglein 1. PMID:15140227
  32. The AACC insertion in the SCCE gene may result in a change to SCCE activity within the skin barrier so SCCE could have an important role in the development of atopic dermatitis. PMID:15191543
  33. Squamous cervical cancer expressed high levels of SCCE, suggesting that this protease may play an important role in invasion and metastasis. PMID:15297163
  34. in normal skin the LG system transports and secretes LEKTI earlier than KLK7 and KLK5 preventing premature loss of stratum corneum integrity/cohesion. PMID:15675955
  35. variability in KLK5 and KLK7 gene expression might be involved in lung tumorigenesis PMID:15766562
  36. in majority of patients with Netherton syndrome, Dsg1 & Dsc1 were reduced in living layers of epidermis; SCTE-like & SCCE-like activities were increased, suggesting these proteases participate in premature degradation of corneodesmosomal cadherins PMID:16628198
  37. KLK5 and KLK7 were shown to control activation of CAP18 and also influence further processing to smaller peptides with alternate biological activity; the balance of proteolytic activity at an epithelial interface will control innate immune defense PMID:17012259
  38. x-ray structures of recombinant active K7 at medium and atomic resolution PMID:17909180
  39. in 99 children and adults with atopic dermatitis found that an association with KLK7 4bp insertion polymorphism was not confirmed. PMID:17989887
  40. predominant localisation of KLK5 and KLK7 in acinar cells of the exocrine pancreas; KLK5 and KLK7 generate transcripts in pancreas variant from those in skin or ovary PMID:18163887
  41. Expression of KLK7, a novel biomarker for advanced ovarian carcinoma, was determined by a novel in situ quantitative method. PMID:18325919
  42. Data show that hK7 was crystallized, and its three-dimensional structure was solved in the absence of protease inhibitors. A model of the interaction between the protease and its inhibitor is proposed. PMID:18329042
  43. KLK7 is able to cleave fibronectin in a time-dependent manner, but not laminin. PMID:18343220
  44. KLK7 insertion appears to confer no risk of eczema; no interaction between the SPINK5 risk allele or the putative KLK7 risk allele and FLG mutations was found PMID:18774391
  45. Expression of kallikrein 7 diminishes pancreatic cancer cell adhesion to vitronectin and enhances urokinase-type plasminogen activator receptor shedding. PMID:18953252
  46. hK7 and ALP were decreased in malignant prostate epithelium. PMID:18976018
  47. kallikreins 5, 7, 8, and 10 are abundantly expressed in human OSCC and may be implicated in malignant progression PMID:19085836
  48. expression of K7 in BxPC-3 cells resulted in increase in shedding of soluble desmoglein 2 consistent with notion that aberrant expression of K7 in pancreatic tumors may result in diminished cell adhesion & facilitate tumor cell invasion PMID:19091121
  49. reduced expression of LEKTI and increased expression of SCCE and SCTE in human epidermal keratinocytes after UVB irradiation may contribute to desquamation of the stratum corneum. PMID:19118981
  50. Data suggest that KLK7 gene is up-regulated in colon cancer and its expression predicts poor prognosis for colon cancer patients. PMID:19350120

Show More

Hide All

Subcellular Location
Secreted. Note=In ovarian carcinoma, secreted and also observed at the apical membrane and in cytoplasm at the invasive front.
Protein Families
Peptidase S1 family, Kallikrein subfamily
Tissue Specificity
Abundantly expressed in the skin and is expressed by keratinocytes in the epidermis. Also expressed in the brain, mammary gland, cerebellum, spinal cord and kidney. Lower levels in salivary glands, uterus, thymus, thyroid, placenta, trachea and testis. Up
Database Links

HGNC: 6368

UNIGENE: Hs.151254

KEGG: hsa:5650

STRING: 9606.ENSP00000375683

OMIM: 604438

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1