Recombinant Human Interferon lambda receptor 1 (IFNLR1), partial

In Stock
Code: CSB-EP816871HU1a2
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$256
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: N-terminal 6xHis-SUMO-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
IFNLR1
Uniprot NO.
Research Area
Immunology
Alternative Names
(IFN-lambda receptor 1)(IFN-lambda-R1)(Cytokine receptor class-II member 12)(Cytokine receptor family 2 member 12)(CRF2-12)(Interleukin-28 receptor subunit alpha)(IL-28 receptor subunit alpha)(IL-28R-alpha)(IL-28RA)(Likely interleukin or cytokine receptor 2)(LICR2)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
21-228aa
Target Protein Sequence
RPRLAPPQNVTLLSQNFSVYLTWLPGLGNPQDVTYFVAYQSSPTRRRWREVEECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLFEVEPAPPVLVLTQTEEILSANATYQLPPCMPPLDLKYEVAFWKEGAGNKTLFPVTPHGQPVQITLQPAASEHHCLSARTIYTFSVPKYSKFSKPTCFLLEVPEANWA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
36.6 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
The IFNLR1/IL10RB dimer is a receptor for the cytokine ligands IFNL2 and IFNL3 and mediates their antiviral activity. The ligand/receptor complex stimulate the activation of the JAK/STAT signaling pathway leading to the expression of IFN-stimulated genes (ISG), which contribute to the antiviral state. Determines the cell type specificity of the lambda interferon action. Shows a more restricted pattern of expression in the epithelial tissues thereby limiting responses to lambda interferons primarily to epithelial cells of the respiratory, gastrointestinal, and reproductive tracts. Seems not to be essential for early virus-activated host defense in vaginal infection, but plays an important role in Toll-like receptor (TLR)-induced antiviral defense. Plays a significant role in the antiviral immune defense in the intestinal epithelium.
Gene References into Functions
  1. IFN-lambda4 suppressed HIV infection of macrophages. This IFN-lambda4-mediated HIV inhibition was compromised by the antibodies against IFN-lambda receptor complex, IFN-lambdaR1/IL-10R2. PMID:30247785
  2. Significant associations were observed for 4 variants in IFNAR2, IFNLR1 with hepatitis B virus infection, and IFNLR1-rs4649203 was associated with hepatitis B recovery. Moreover, the authors demonstrated the clear relevance of 5 polymorphisms in IFNA1, IFNA2, IFNL4 with hepatocellular carcinoma. PMID:29080269
  3. In this structure, the receptor peptide forms an 85-A-long extended chain, in which both the previously identified box1 and box2 regions bind simultaneously to the FERM and SH2-like domains of JAK1. PMID:27725180
  4. Results show that IFNLR1 box1 and box2 motifs are required for stable complex formation with JAK1 and the crystal structure of JAK1 reveals IFNLR1 box1 binding site in the FERM domain. Also, structure-based mutagenesis reveals IFNLR1 PxxLxF motif that is essential for binding. Structure of JAK1 with IL10RA box1 indicates conservation among class II receptors. PMID:27133025
  5. Selective expression of IFNlambdaR1 was considered to be a plus point towards the targeted anti-viral activity of IFNlambdas but artificial control on its expression will surely make IFNlambdas a better drug with enhanced activity. PMID:27166550
  6. expression of IL-28RA mRNA may be correlated with the pathogenesis of systemic lupus erythematosus PMID:25911176
  7. Polymorphism within the IL-28R1, but not in IL-28B, is associated with benign prostatic hyperplasia and lower urinary tract symptoms in Chinese. PMID:26400298
  8. Results show that the distribution of IL10RB and IL28RA genotypes among the Hepatitis C virus-infected and control groups did not differ significantly. PMID:24144988
  9. This study is the first to show the activation of a type III interferon response in low-risk human papillomavirus positive cervical cells and suggests that the lack of this response may be related to lesion progression. PMID:24510368
  10. IL28RA polymorphism (rs10903035) seems to be implicated in the glucose homeostasis because AA genotype increases the likelihood of IR, but this association was different depending on hepatic fibrosis and HCV genotype. PMID:24438680
  11. Epigenetic reprogramming of IFNLR1-mediated response potentiates antiviral activity and suppresses tumor growth. PMID:24409098
  12. IFN-lambda receptor 1 expression is induced in chronic hepatitis C and correlates with the IFN-lambda3 genotype and with nonresponsiveness to IFN-alpha therapies. PMID:24752298
  13. The rs12980275 AG/GG genotype and rs10903035 G allele remained independently associated with early pegylated interferon and ribavirin failure of hepatitis C in hepatitis C/HIV coinfected patients. PMID:23565619
  14. Plasmacytoid dendritic cells are major producers of IFN-lambda2 (a type III interferon) in response to viral stimulation and also express functional receptors for this cytokine. PMID:22891284
  15. No consistent association is found between IL28RA and multiple sclerosis in a Basque-Spanish population. PMID:22386267
  16. two SNPs in IL28RA are correlated with susceptibility to HCV infection and spontaneous viral clearance, which implicates a primary role of IL28RA in the outcomes of HCV infection PMID:21742059
  17. IFN-lambdaR1 consists of two distinct domains having fibronectin type III topology. PMID:20934432
  18. Although the IFN-lambda1(Bac)-IFN-lambda1R1 and IFN-lambda1(Ins)-IFN-lambda1R1 complexes differed only in the nature of the expression system used for the ligand, their crystallization conditions and crystal forms were quite different PMID:20057073
  19. study supports that IFN-lambdas do not influence every type of cell and that membrane-associated variant IFN-lambda R1 expression is not sufficient to ensure cellular sensitivity toward these cytokines. PMID:19798076
  20. IL-28 and IL-29 interact with a heterodimeric class II cytokine receptor that consisted of IL-10 receptor beta (IL-10Rbeta) and an orphan class II receptor chain, designated IL-28Ralpha. PMID:12469119
  21. distinct receptor complex that is utilized by all three IFN-lambda proteins for signaling and is composed of two subunits, a receptor designated CRF2-12 (also designated as IFN-lambdaR1) and a second subunit, CRF2-4 (also known as IL-10R2) PMID:12483210
  22. interleukin (IL)-28 receptor tyrosine residues have roles in antiviral and antiproliferative activity of IL-29/interferon-lambda 1 PMID:15166220
  23. Results suggested that the g.32349 G>A polymorphism of IL-28RA might be associated with susceptibility to allergic rhinitis. PMID:16819289

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Protein Families
Type II cytokine receptor family
Tissue Specificity
Widely expressed.
Database Links

HGNC: 18584

UNIGENE: Hs.221375

KEGG: hsa:163702

STRING: 9606.ENSP00000327824

OMIM: 607404

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products