Recombinant Human Interleukin-23 subunit alpha (IL23A)

Code: CSB-MP868278HU
Size:
20ug
20ug100ug1mg
US$138
Quantity:
Express system: Mammalian cell
Species: Homo sapiens (Human)
Tag Info: C-terminal 10xHis-HSA-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human IL23A protein
Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
IL23A
Uniprot NO.
Research Area
Others
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
20-189aa
Target Protein Sequence
RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
86.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 10xHis-HSA-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Associates with IL12B to form the IL-23 interleukin, a heterodimeric cytokine which functions in innate and adaptive immunity. IL-23 may constitute with IL-17 an acute response to infection in peripheral tissues. IL-23 binds to a heterodimeric receptor complex composed of IL12RB1 and IL23R, activates the Jak-Stat signaling cascade, stimulates memory rather than naive T-cells and promotes production of proinflammatory cytokines. IL-23 induces autoimmune inflammation and thus may be responsible for autoimmune inflammatory diseases and may be important for tumorigenesis.
Gene References into Functions
  1. IL23 and IL17 have roles in the pathogenesis of Tunisian pemphigus foliaceus PMID:30116153
  2. Effect of polymorphisms in IL-12B p40, IL-17A and IL-23 A/G genes on the response of psoriatic patients to narrowband UVB. PMID:29763989
  3. Epigenetic control of IL-23 expression in keratinocytes is important for chronic skin inflammation. PMID:29650963
  4. IL-23 binding to its receptor promotes the migration and invasion of gastric cancer cells by inducing epithelial-to-mesenchymal transition through the STAT3 signaling pathway. PMID:29574157
  5. TNF-alpha plays an important role for the autocrine stimulation of IL-23 production by 6-sulfo LacNAc(+) dendritic cells. PMID:27315572
  6. The expression of IL-17 and IL-12 in patients with lupus miliaris disseminatus faciei is reported in patients and healthy controls. PMID:27515793
  7. SIGIRR is both a negative regulator of TLR4 and a positive regulator of TLR7/8. PMID:28869081
  8. interleukin 23 (IL-23)/T-helper 17 (TH 17) immune axis has been identified as a major immune pathway in psoriasis disease pathogenesis PMID:28653490
  9. Serum IL-17 and IL-23 values positively correlated with serum total IgE levels. Serum levels of IL-10 were lower in children with atopy and dyslipidemia than patients with dyslipidemia. PMID:28692864
  10. IL-23/IL-17 axis and biochemical markers in the pathogenesis of Type 2 Diabetes PMID:28757426
  11. Higher levels of TGF-beta mRNA were observed in biopsies taken from healthy controls, and the IL-23 mRNA levels were significantly increased in the peri-implantitis group (P < 0.0001). No differences in IL-17 mRNA levels were observed between the two groups (P > 0.05). PMID:27062688
  12. clinical significance of IL-17 and IL-23 in the pathogenesis of different types of gastric neoplasms in humans, is reported. PMID:27869179
  13. this study shows neuroprotective effects of G-CSF administration in microglia-mediated reactive T cell activation in vitro in a mouse model PMID:28646409
  14. NOD2 up-regulates TLR2-mediated IL-23p19 expression via increasing c-Rel activation in Paneth cell-like cells PMID:27563808
  15. Serum IL-23 and IL-17 levels were elevated in patients with aneurysmal subarachnoid hemorrhage (aSAH) showing upregulation of IL-23/IL-17 inflammatory axis after aSAH. Serum IL-23 and IL-17 showed differential correlations with post hemorrhagic complications and no correlation with clinical outcome. PMID:28609751
  16. IL-23, alone and in combination with IL-18 and sRAGE, identified bacterial meningitis with excellent accuracy. Following validation, these markers could aid clinicians in diagnosis of bacterial meningitis and decision-making regarding prolongation of antibiotic therapy PMID:29394248
  17. Serum IL-17F predicted increased knee bone marrow lesion scores in females only among patients with knee osteoarthritis. PMID:27836676
  18. Our discoveries demonstrate that autocrine IL-23 contribute to ovarian cancer malignancy through promoting the self-renewal of CD133+ ovarian cancer stem-like cells, and this suggests that IL-23 and its signaling pathway might serve as therapeutic targets for the treatment of ovarian cancer. PMID:27738346
  19. Study of IL-23 showed reduced levels of expression in aged humans compared to young. PMID:28509479
  20. IL-23 activates gammadelta T cells in early stage PNS, which amplifies the Th17 cell population and leads to kidney injury through the secretion of IL-21. PMID:29119640
  21. serum IL-23 levels reflect obstructive sleep apnea syndrome -related systemic inflammation and are a useful marker for improvement following continuous positive airway pressure therapy PMID:27665460
  22. This study is the first to demonstrate an effect of HIV on the IL-23 signaling pathway in Th17 cells. We show that in vitro and in vivo HIV infection results in impaired IL-23 signaling which is not reversed by HAART nor is it a result of reduced receptor expression, suggesting that HIV interferes with IL-23-activated signaling pathways PMID:29091911
  23. We conclude that variants in IL-23A and IL-23R genes were associated with the risk of multiple sclerosis or other inflammatory demyelinating diseases. PMID:27893410
  24. results confirm the role of IFN-gamma and support the involvement of IL-23/Th17-related cytokines in BCC pathogenesis and in the inflammatory response during IMQ and MAL-PDT treatments PMID:28829805
  25. An increase in CSF mean levels of IL-23 was observed in amyotrophic lateral sclerosis patients. PMID:27245439
  26. results show that IL-23 accounts for the main aspects of human and murine lupus including the expansion of double negative T cells, decreased IL-2, and increased IL-17 production PMID:28646040
  27. Serum Levels of IL-17A and IL-23 Are Associated with Decreased Vitamin D3 and Increased Pain in Osteoarthritis PMID:27820818
  28. this study shows that latent cytomegalovirus induces IL-23. IL-23 might be an inflammatory mediator of latent cytomegalovirus infection in patients with rnd-stage renal diseases, and predisposes patients for post-transplant cytomegalovirus reactivation PMID:27716059
  29. These finding may provide a molecular mechanism involved in sustained ER stress in AS BdCs stimulates the activation of RUNX2 and C/EBPbeta genes, leading to IL-23 production. PMID:28728847
  30. The link between increased expression of TH17 pathway cytokines and clinical disease severity raises the possibility of a new therapeutic paradigm of targeted IL-17/IL-23 intervention for patients with ichthyosis PMID:27554821
  31. this study shows that elevated iserum IL-23 is associated with mortality in chronic hepatitis B virus, acute-on-chronic liver failure patients, and that IL-23 neutralizing antibodies attenuated liver injury by reducing the expression of Th17-related inflammatory cytokines, neutrophil chemoattractants and stabilization factors within the liver tissue PMID:28282579
  32. this study shows that IL-23 promotes IL-17+IFN-gamma- T cell expansion in multi-drug-resistant tuberculosis PMID:27681197
  33. our results suggest that IL-39 induces differentiation and/or expansion of neutrophils in lupus-prone mice. PMID:27400195
  34. The results of this case-control study suggest that IL-12A, IL-12B, IL12RB1, IL12RB2 and IL23R make no genetic contribution to the susceptibility of Takayasu arteritis in Chinese populations PMID:26987707
  35. High IL-23 expression is associated with polycystic ovary syndrome. PMID:27146815
  36. this study shows that for pre-school children with history and physical exam in favor of asthma which cannot be tested by spirometry, IL-23 serum levels may be an auxiliary biomarker for the diagnosis of asthma PMID:28341820
  37. Data show that the number of interleukin 17 (IL-17) positive cells significantly correlated positively with the number of interleukin-23 (IL-23) positive cells in skin PMID:27388654
  38. Interleukin 17A (Il17a) and interleukin-23 (IL-23) - dependent interleukin-17 Receptor C (IL-17RC) are expressed by sputum and neutrophils in deltaF508-CFTR protein (F508del) cystic fibrosis patients. PMID:27155366
  39. suberoylanilide hydroxamic acid significantly inhibited IL-12p40 and IL-23p19 mRNA synthesis and did not change IL-12p35 mRNA transcription. PMID:27240992
  40. this study shows that single nucleotide polymorphisms of the IL23R-IL12RB2 region are associated with Behcet's disease in a Northern Chinese Han population PMID:27660093
  41. this study shows that double-negative T cells from systemic lupus erythematosus patients are more expanded when stimulated in vitro with recombinant IL-23 than controls PMID:27343994
  42. Increased expression of interleukin-23 associated with progression of colorectal cancer. PMID:27807862
  43. The levels of IL-17, one of the major effector cytokines of the Th17 system, and IL-23, which had been implicated in the generation, survival and expansion of Th17 cells, are altered in Hashimoto's thyroiditis (HT). PMID:26928603
  44. Intracellular p19 associated with the cytokine receptor subunit gp130 and stimulated the gp130-dependent activation of signal transducer and activator of transcription 3 (STAT3) signaling PMID:26980441
  45. may role in the pathogenesis of arthritis and may be a useful biomarker for the diagnosis of this disease PMID:26709220
  46. we showed that elevated IL-17/IL-23 serum concentrations helped to discriminate BP patients who later relapsed. PMID:26656739
  47. The expression of IL-23 significantly increased in chronic atrophic gastritis with intestinal metaplasia tissues and gastric cancer tissues. PMID:27053620
  48. that consumption of star fruit juice at 100g twice daily for one month can significantly depress the pro-inflammation cytokines: TNF-alpha, IL-23, and NO, while increasing walking distance. PMID:26952371
  49. IL-23 mediates the differentiation of Th17 and Treg cells and the production of associated cytokines in DICs. The potential mechanism likely involves the STAT3 pathway. PMID:26657845
  50. Clostridium difficile toxins A and B induce IL-23 mRNA expression in human dendritic cells. PMID:25626905

Show More

Hide All

Subcellular Location
Secreted. Note=Secreted upon association with IL12B.
Protein Families
IL-6 superfamily
Tissue Specificity
Secreted by activated dendritic and phagocytic cells and keratinocytes. Also expressed by dermal Langerhans cells (at protein level).
Database Links

HGNC: 15488

UNIGENE: Hs.382212

KEGG: hsa:51561

STRING: 9606.ENSP00000228534

OMIM: 605580

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products