Abbreviation
Recombinant Human IL1RL1 protein, partial (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA.Immobilized Human IL1RL1 at 2 μg/mL can bind Anti-IL1RL1 recombinant antibody(CSB-RA011626MA1HU). The EC50 is 6.366-7.698 ng/mL.
②Measured by its binding ability in a functional ELISA.Immobilized Human IL1RL1 at 2 μg/mL can bind Anti-IL1RL1 recombinant antibody(CSB-RA011626MA2HU). The EC50 is 11.85-13.96 ng/mL.
Alternative Names
Interleukin-1 receptor-like 1; EC:3.2.2.6; Protein ST2; IL1RL1; DER4, ST2, T1
Species
Homo sapiens (Human)
Expression Region
19-323aa
Target Protein Sequence
KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNP
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
①Measured by its binding ability in a functional ELISA.Immobilized Human IL1RL1 at 2 μg/ml can bind Anti-IL1RL1 recombinant antibody(CSB-RA011626MA1HU). The EC50 is 6.366-7.698 ng/mL.
-
Activity
②Measured by its binding ability in a functional ELISA.Immobilized Human IL1RL1 at 2 μg/ml can bind Anti-IL1RL1 recombinant antibody(CSB-RA011626MA2HU). The EC50 is 11.85-13.96 ng/mL.
-
The purity of IL1RL1 was greater than 95% as determined by SEC-HPLC
Description
IL1RL1, also known as ST2, functions as a decoy receptor in IL-33 signaling and serves as a biomarker in cardiovascular inflammation and heart failure research. This mammalian-expressed construct spanning residues 19–323 captures the extracellular ligand-binding domain, and functional ELISA validation demonstrates robust antibody binding with EC50 values of 6.4–7.7 ng/mL and 11.9–14.0 ng/mL for two distinct anti-IL1RL1 antibodies, confirming conformational integrity suitable for receptor-ligand interaction studies and therapeutic antibody epitope mapping. The quantified binding kinetics support its use in competitive inhibition assays, blocking antibody screening, and as a positive control in SPR or BLI affinity characterization experiments targeting the IL-33/ST2 axis. Purity exceeding 95% by both SDS-PAGE and SEC-HPLC, combined with endotoxin levels below 1.0 EU/μg, aligns with standards expected in sensitive binding assays and antibody development workflows where low contaminant interference is critical.