Recombinant Human Integrin alpha-M (ITGAM), partial

Code: CSB-EP011876HU
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$306
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: N-terminal 6xHis-GST-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
ITGAM
Uniprot NO.
Research Area
Neuroscience
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
46-150aa
Target Protein Sequence
VLFQGPLGSPEFRTVVVGAPQEIVAANQRGSLYQCDYSTGSCEPIRLQVPVEAVNMSLGLSLAATTSPPQLLACGPTVHQTCSENTYVKGLCFLFGSNLRQQPQKFPEALRGCPQEDSDGRTRAPPPPPLRSGCQSPKGSVGCCHRAITSITPWGLTGLEGFFAERRNYIRIGEWDAPCSGALSAAGVVVTRSVTATLASALAPAPFAFFPSFLATFAGFPRQALNRGLPLGFRFSALRHL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
57.1 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-GST-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Integrin ITGAM/ITGB2 is implicated in various adhesive interactions of monocytes, macrophages and granulocytes as well as in mediating the uptake of complement-coated particles and pathogens. It is identical with CR-3, the receptor for the iC3b fragment of the third complement component. It probably recognizes the R-G-D peptide in C3b. Integrin ITGAM/ITGB2 is also a receptor for fibrinogen, factor X and ICAM1. It recognizes P1 and P2 peptides of fibrinogen gamma chain. Regulates neutrophil migration. In association with beta subunit ITGB2/CD18, required for CD177-PRTN3-mediated activation of TNF primed neutrophils. May regulate phagocytosis-induced apoptosis in extravasated neutrophils. May play a role in mast cell development. Required with TYROBP/DAP12 in microglia to control production of microglial superoxide ions which promote the neuronal apoptosis that occurs during brain development.
Gene References into Functions
  1. A significant reduction of CD11b expression on monocytes and granulocytes, as a sign of reduced cellular inflammation, was achieved by treatment of atrial fibrillation using pulmonary vein isolation. PMID:28073885
  2. Expression of Mac-1 on the surface of human embryonic kidney (HEK) 293 cells induced their adhesion and migration to PTN. Accordingly, PTN promoted Mac-1-dependent cell spreading and initiated intracellular signaling manifested in phosphorylation of Erk1/2. PMID:28939773
  3. CD11b rs1143679 polymorphism appears to be associated with risk for SLE in the Han Chinese population, and may play an important role in the development of lupus nephritis. PMID:29207897
  4. alphaMbeta2 uses its alphaI domain to bind iC3b at the thioester domain and simultaneously interacts through a region near the alphaM beta-propeller and beta2 betaI domain with a region of the C3c moiety near the C345C domain. PMID:28292891
  5. Up-regulation of granulocyte and monocyte CD11b during plasma separation was C5-dependent. PMID:29575196
  6. This study shown the ITGAM expression in Microglia and Astrocytes in stroke, Alzheimer's disease, and Lewy body dementia. PMID:28398520
  7. CD11b expression on polymorphonuclear leukocytes from patients with ankylosing spondylitis stimulated with lipopolysaccharide is not different to that of healthy controls. PMID:24373176
  8. The use of CD33(+)CD11b(+)HLA-DR(-) cells as a predictive and prognostic biomarker. PMID:27178742
  9. Bone marrow mesenchymal stromal cells induce the rapid differentiation of CD11b+ myeloid cells from bone marrow progenitors, and such an activity requires the expression of nitric oxide synthase-2. PMID:28183849
  10. demonstrate for the first time a dependency of monocyte-platelet aggregates and CD11b expression on monocytes in the presence of atrial fibrillation (AF) and support the notion of a close relationship between AF, thrombogenesis and inflammation PMID:26763077
  11. Increased CD11b+ and CD200+ monocytes in those with a strong presence of BVN indicate that BVN development may be associated with retinal injury and a VEGF-mediated process that is either reflected or propelled by systemic changes in monocytes. PMID:29049725
  12. This study, we provide evidence supporting a crucial pathogenic role for alphaM-integrin (CD11b) in acute inflammatory demyelinating polyradiculoneuropathy mononuclear leukocyte trafficking. PMID:27460017
  13. TLR-stimulated macrophages from CD11B SNP carriers showed increased basal expression of IFN regulatory factor 7 (IRF7) and IFN-beta, as well as increased nuclear exclusion of FOXO3, which was suppressed by LA1-dependent activation of CD11b. PMID:28263189
  14. FRbeta as a novel CD11b/CD18 regulator for trafficking and homing of a subset of macrophages on collagen. PMID:27534550
  15. this study shows that upregulation of CD11b after stimulation with IL-8 is more pronounced in adults than in neonates, whereas fMLP induces changes in receptor expression that are of the same magnitude in neutrophils from neonates as from adults PMID:27606963
  16. Ingestion of amino acid supplement did not influence CD11b expression. PMID:27384580
  17. This metaanalysis indicates that polymorphisms in the pathways of immune complex clearance, such as the FcgammaRIIIa, FcgammaRIIIb, and ITGAM genotypes, are potential susceptibility genes for neuropsychiatric systemic lupus erythematosus. PMID:26773105
  18. Monocyte-platelet aggregates and CD11b expression on monocytes and granulocytes are increased in atrial fibrillation patients with proven thrombus formation. They seem to be appropriate biomarkers for stratification of thromboembolic risk in patients with AF. PMID:26411420
  19. CD11b immunophenotyping identifies inflammatory profiles in the mouse and human lungs. PMID:26422753
  20. There is direct interaction between C3(H2O) and CD11b. Contact-activated C3(H2O) is a novel ligand for CD11b/CD18 that mediates platelet-PMN complex formation and the binding of platelet-derived microparticles to PMNs. PMID:26293614
  21. increased in neonates with abnormal neuroimaging and/or severe neonatal encephalopathy PMID:25655529
  22. Data show that secreted aspartic protease 2 (Sap2) of Candida albicans inactivates human macrophage complement factor H (factor H), factor H-receptors CD11b/CD18 and CD11c/CD18. PMID:26306739
  23. we confirmed the similarities between epithelial ovarian cancer and fallopian tube, normal and adenocarcinoma using FOLR1, FOLR2, CD68 and CD11b markers PMID:25971554
  24. While total surface expression of CD11b and L-selectin on neutrophils was largely unaffected PMID:26361072
  25. CD11b expression level might be considered a prognostic biomarker for Acute Myeloid Leukemia patients. [meta-analysis] PMID:26309131
  26. analysis of neutrophil and monocyte expression of toll-like receptor 4, CD11b and reactive oxygen intermediates, and correlation with neuroimaging outcomes in preterm infants PMID:25826119
  27. The rs1143679 polymorphism is associated with systemic lupus erythematosus susceptibility in different ethnic groups and with lupus nephritis in Europeans. No association was found with rheumatoid arthritis. [Meta-Analysis] PMID:25315704
  28. the results identify dynorphins A and B as novel ligands for Mac-1. PMID:26036990
  29. A novel expanding CD11b+ conventional dendritic cell subpopulation dominates the infiltrating renal inflammatory milieu, localizing to the glomeruli, in lupus nephritis. PMID:26512111
  30. Modification of Levels of Adhesion Molecule Expression of Human Innate Immune Cells by Glycopolymers of Marine Bacteria PMID:26852488
  31. study supports the crucial role of GABP in myeloid cell differentiation and identified ITGAM/CD11b as a novel GABP target gene PMID:26170143
  32. Data indicate that Candida albicans beta-Glucan induces high IL-1 receptor antagonist (IL-1Ra) levels, independently from Dectin-1/complement receptor 3 (CR3). PMID:25461401
  33. A novel association of common variable immunodeficiency have been found with rare variants at the FUS/ITGAM (CD11b) locus on 16p11.2. PMID:25678086
  34. role of CD11b/CD18 in priming of human leukocytes by endotoxin glycoforms from Escherichia coli PMID:25365491
  35. Il-6-induced recruitment of CD11b+ CD14+ HLA-DR- myeloid-derived suppressor cells is associated with progression and poor prognosis in squamous cell carcinoma of the esophagus. PMID:25238263
  36. Results show the functional importance of integrin alpha M (ITGAM) in systemic lupus erythematosus (SLE) pathogenesis through impaired phagocytosis. PMID:24886912
  37. Examination of CR3 ( CD11b/CD18)mutant variants and mass spectrometry analysis of the N-glycosylation pattern of CR3 revealed that N-glycans located in the C-terminal part of the CD11b subunit are involved in binding and cytotoxic activity of CyaA. PMID:25554420
  38. newly revealed recognition specificity of alpha(M)beta2 toward unfolded protein segments and cationic proteins and peptides suggests that alpha(M)beta2 may serve as a previously proposed "alarmin" receptor with important roles in innate host defense PMID:25613106
  39. The HNA-1b allotype influences the Fc gamma RIIIb cooperation with Fc gamma RIIa, but not with CR3. PMID:24945596
  40. The altered expression levels of ITGAM and FCgammaRIIIA mRNA in systemic lupus erythematosus patients and their correlations with clinical data suggest that ITGAM and FCgammaRIIIA may play a role in this disease. PMID:23708937
  41. The transcript levels of ITGAM significantly decreased for the systemic lupus erythematosus risk allele (A) relative to the non-risk allele (G), in a dose-dependent fashion. PMID:24608226
  42. A new genome-wide significant association between ITGAM-ITGAX and IgA nephropathy. PMID:25305756
  43. A negative correlation was found between CD11b percentage and postinfarct left ventricular ejection fraction. PMID:25136078
  44. hnRNP K in PU.1-containing complexes recruited at the CD11b promoter: a distinct role in modulating granulocytic and monocytic differentiation of AML-derived cells. PMID:25005557
  45. This suggests that FcgammaRIIIb signals in association with macrophage-1 Ag. PMID:25024378
  46. Although CD11b was more frequently expressed in blast cells of patients with intermediate and unfavorable cytogenetic risk groups, this feature did not translate into different clinical outcome. PMID:24782118
  47. circulating trisomy 12 CLL cells also have increased expression of the integrins CD11b, CD18, CD29, and ITGB7, and the adhesion molecule CD323. PMID:24829201
  48. integrin alpha9beta1/CD11B levels in circulating neutrophils are significantly elevated in pneumonia patients PMID:23257917
  49. genetic polymorphism is associated with systemic lupus erythematosus in Brazilian patients PMID:24269694
  50. Complement receptor 3 (CR3) inhibition impairs phagocytosis of serum-opsonized zymosan but has little impact on phagocytosis of unopsonized zymosan in the absence or presence of lipopolysaccharide. PMID:24726062

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein. Membrane raft; Single-pass type I membrane protein.
Protein Families
Integrin alpha chain family
Tissue Specificity
Predominantly expressed in monocytes and granulocytes. Expressed in neutrophils (at protein level).
Database Links

HGNC: 6149

UNIGENE: Hs.172631

KEGG: hsa:3684

STRING: 9606.ENSP00000441691

OMIM: 120980

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products