Abbreviation
Recombinant Human IGFBP7 protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CD93 (CSB-MP865099HU) at 5 μg/mL can bind Human IGFBP7. The EC50 is 3.405-5.456 ng/mL.
Alternative Names
Insulin-like growth factor-binding protein 7; IBP-7; IGF-binding protein 7; IGFBP-7; IGFBP-rP1; MAC25 protein; PGI2-stimulating factor; Prostacyclin-stimulating factor; Tumor-derived adhesion factor (TAF); IGFBP7;MAC25, PSF
Species
Homo sapiens (Human)
Expression Region
27-282aa
Target Protein Sequence
SSSDTCGPCEPASCPPLPPLGCLLGETRDACGCCPMCARGEGEPCGGGGAGRGYCAPGMECVKSRKRRKGKAGAAAGGPGVSGVCVCKSRYPVCGSDGTTYPSGCQLRAASQRAESRGEKAITQVSKGTCEQGPSIVTPPKDIWNVTGAQVYLSCEVIGIPTPVLIWNKVKRGHYGVQRTELLPGDRDNLAIQTRGGPEKHEVTGWVLVSPLSKEDAGEYECHASNSQGQASASAKITVVDALHEIPVKKGEGAEL
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal hFc1-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human CD93 (CSB-MP865099HU) at 5 μg/ml can bind Human IGFBP7. The EC50 is 3.405-5.456 ng/mL.
Description
IGFBP7 engages CD93 to modulate angiogenic signaling and cellular adhesion, making their interaction a key target in vascular biology and tumor microenvironment research. This recombinant human IGFBP7 (aa 27–282, full-length mature protein) carries a C-terminal hFc1 tag and demonstrates validated binding to human CD93 with an EC50 of 3.405–5.456 ng/mL in functional ELISA, providing a reliable basis for receptor-ligand binding assays, SPR kinetic studies, and cell-based adhesion or angiogenesis experiments. Mammalian cell expression preserves native glycosylation and folding critical for IGFBP7's multi-domain architecture, while purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg satisfy the criteria typical for functional cell assays and in vivo studies where endotoxin interference must be minimized. The hFc1 tag additionally supports use as an immunogen for antibody development or as a capture molecule in plate-based interaction screening.
