Recombinant Human Inhibin beta C chain (INHBC)

Baculovirus
Mammalian cell

Code
MSDS	MSDS Datasheet
Size	Pls inquire
Source
Conjugate
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

>85% (SDS-PAGE)

Target Names

INHBC

Uniprot NO.

P55103

Alternative Names

Activin beta C chain; Activin beta-C chain; IHBC; Inhbc; INHBC_HUMAN; Inhibin beta C chain; Inhibin, beta C

Species

Homo sapiens (Human)

Source

Yeast

Expression Region

237-352aa

Target Protein Sequence

GIDCQGGSRMCCRQEFFVDFREIGWHDWIIQPEGYAMNFCIGQCPLHIAGMPGIAASFHTAVLNLLKANTAAGTTGGGSCCVPTARRPLSLLYYDRDSNIVKTDIPDMVVEACGCS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8

Storage Condition

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Inhibins and activins inhibit and activate, respectively, the secretion of follitropin by the pituitary gland. Inhibins/activins are involved in regulating a number of diverse functions such as hypothalamic and pituitary hormone secretion, gonadal hormone secretion, germ cell development and maturation, erythroid differentiation, insulin secretion, nerve cell survival, embryonic axial development or bone growth, depending on their subunit composition. Inhibins appear to oppose the functions of activins.

Gene References into Functions

Study shows an up-regulation of activin-C in aggressive prostate cancer only, suggesting that activin-C may play a role in the advanced stages of the disease. PMID:28116672
The inhibin-betaC subunit is down-regulated, while inhibin-betaE is up-regulated by interferon-beta1a in Ishikawa carcinoma cell line. PMID:23580013
Single Nucleotide Polymorphisms in INHBC gene is associated with brain metastasis in non-small-cell lung cancer PMID:23284751
Activin-beta(C) is a regulator of activin-A. Activin-beta(C) is able to abolish cachexia and modulate reproductive tumour development in inhibin alpha-subunit knockout mice (alpha-KO) mice. PMID:23180294
inhibin-betaC in normal and pathological placental tissue was demonstrated, although no differences in staining intensity could be observed. Functional role of novel inhibin-betaC subunit in normal and pathological human placenta is still quite unclear. PMID:21117833
in endometrial cancer tissue demonstrated a significant association with hemangiosis although without any impact on the patients' survival PMID:20683603
differential expression pattern of the betaC- and betaE-subunits in normal human endometrial tissue suggests that they function in endometrial maturation and blastocyst implantation. PMID:21092084
the novel inhibin/activin-betaC subunit is expressed in human endometrioid adenocarcinomas and in the human endometrial carcinoma cell line HEC-1a PMID:20952735
Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator) PMID:20884846
Expression of the inhibin betaC and betaE subunits was demonstrated at the protein level and at the transcriptional level in normal human endometrial tissue and in the Ishikawa human endometrial carcinoma cell line. PMID:20012305
Expression of inhibin beta C was detected in the human chorionic carcinoma cell lines JEG and BeWoand also in human placenta. PMID:20458061
Role for the activin betaC-subunit as a regulatory mechanism to reduce activin A secretion via intracellular heterodimerization. PMID:12960042
activin betaC subunit may exert its effect as inhibin C PMID:16627954