Recombinant Human Histone-lysine N-methyltransferase MECOM (MECOM), partial

Code
MSDS
Size Pls inquire
Source
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
MECOM
Uniprot NO.
Alternative Names
Histone-lysine N-methyltransferase MECOM; EC 2.1.1.367; Ecotropic virus integration site 1 protein homolog; EVI-1; MDS1 and EVI1 complex locus protein; Myelodysplasia syndrome 1 protein; Myelodysplasia syndrome-associated protein 1; MECOM EVI1 MDS1 PRDM3
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
78-190
Target Protein Sequence
AEFELRESNMPGAGLGIWTKRKIEVGEKFGPYVGEQRSNLKDPSYGWEILDEFYNVKFCIDASQPDVGSWLKYIRFAGCYDQHNLVACQINDQIFYRVVADIAPGEELLLFMK
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
Functions as a transcriptional regulator binding to DNA sequences in the promoter region of target genes and regulating positively or negatively their expression. Oncogene which plays a role in development, cell proliferation and differentiation. May also play a role in apoptosis through regulation of the JNK and TGF-beta signaling. Involved in hematopoiesis.; Displays histone methyltransferase activity and monomethylates 'Lys-9' of histone H3 (H3K9me1) in vitro. Probably catalyzes the monomethylation of free histone H3 in the cytoplasm which is then transported to the nucleus and incorporated into nucleosomes where SUV39H methyltransferases use it as a substrate to catalyze histone H3 'Lys-9' trimethylation. Likely to be one of the primary histone methyltransferases along with PRDM16 that direct cytoplasmic H3K9me1 methylation.
Gene References into Functions
  1. High EVI1 expression predicts poor outcome in Acute myeloid leukemia with intermediate cytogenetic risk in patients receiving chemotherapy. PMID:29408852
  2. The relationship between EVI1 and microRNAs in human malignancies. [review] PMID:29879503
  3. Fisher's exact SubID was used to reveal EVI1 as a transcriptional regulator of INPP4B in AML; a finding which was validated in vitro. Next, we used CoxPH SubID to conduct a pan-cancer analysis of INPP4B's prognostic significance PMID:29415082
  4. These findings highlight a novel mechanism for hepatitis B virus X-induced hepatocarcinogenesis through transcription factor EVI1 and its target lncRNAs PMID:26967394
  5. Findings represent the first global genome-wide study of EVI1 DNA binding associated with whole transcriptome expression analysis. Results reveal several important genes with an ETS-like binding motif, is involved in terminal myeloid differentiation, cell cycle regulation and apoptosis PMID:23826213
  6. The expression of EVI1 and SOX9 is associated with stem cell-like and metastasis signatures, and their depletion impairs the metastatic potential of breast cancer cells. These results establish the mechanistic link between resistance to mTOR inhibition and cancer metastatic potential, thus enhancing our understanding of mTOR targeting failure PMID:27991928
  7. EVI1 contributes to PCa progression by regulating different oncogenic functions. EVI1 regulates the PCa stem cell compartment responsible for disease initiation and also development of CRPC. PMID:27617580
  8. oncogenic potential for EVI1 in modulating genomic stability PMID:26234679
  9. EVI1 acts as a regulator of its own expression, highlighting the complex regulation of EVI1, and open new directions to better understand the mechanisms of EVI1 overexpressing leukemias. PMID:28391050
  10. EVI1 overexpression alters cellular metabolism. EVI1 promotes CKMT1 expression by repressing the myeloid differentiation regulator RUNX1. PMID:28191887
  11. EVI1 transcription is directly regulated by LEF1/beta-catenin complex in myeloid blast crisis of chronic myeloid leukemia. Loss of p53 function as a key regulator for beta-catenin-EVI1 in myeloid blast crisis of chronic myeloid leukemia. PMID:27908728
  12. we demonstrated that miR-22 promoted monocyte/macrophage differentiation, and MECOM (EVI1) mRNA is a direct target of miR-22 and MECOM (EVI1) functions as a negative regulator in the differentiation.The miR-22-mediated MECOM degradation increased c-Jun but decreased GATA2 expression, which results in increased interaction between c-Jun and PU.1 PMID:27617961
  13. Results establish the oncogenic contributions of EVI1 in ER- and HER2-negative subsets of breast cancer. PMID:28209621
  14. MECOM gene harbors both somatic frameshift mutations. PMID:27620344
  15. Isochromosome 3q, especially MECOM abnormality, could play a key role in Persistent polyclonal binucleated B-cell lymphocytosis. PMID:26935937
  16. MECOM deletion is associated with congenital thrombocytopenia. PMID:26554871
  17. involvement of MECOM in patients with acute myeloid leukemia and myelodysplastic syndrome with various 3q abnormalities PMID:26815134
  18. RUNX1-Evi-1 may promote proliferation and apoptosis resistance of primitive hematopoietic cell, and inhibit the differentiation of myeloid cells with the synergy of different pathways and factors. PMID:26674644
  19. EVI1 overexpression has been revealed as an important independent adverse prognostic marker in adult acute myeloid leukemia and defines distinct risk categories in 11q23-rearranged AML. PMID:26729571
  20. Data suggest that alteration of ecotropic viral integration site-1 (EVI1) expression was more profound in acute lymphoblastic leukemia (ALL) than in acute myeloid leukemia (AML). PMID:24828867
  21. Mutations in MECOM cause radioulnar synostosis with amegakaryocytic thrombocytopenia. PMID:26581901
  22. A RT-qPCR assay was used to quantify EVI1 expression covering the different splice variants in bone marrow and blood in AML. EVI1 expression levels significantly decreased between diagnostic and post-induction samples. PMID:26467814
  23. Low EVI1 expression is associated with chronic lymphocytic leukemia. PMID:25936528
  24. Our data reveal MS4A3 as a novel direct target of EVI1 in human myeloid cells, and show that its repression plays a role in EVI1 mediated tumor aggressiveness. PMID:25886616
  25. EVI1 antagonizes TGF-beta-mediated growth inhibition of hepatocllular carcinoma cells. PMID:25959919
  26. There is breakpoint heterogeneity in (2;3)(p15-23;q26) translocations involving EVI1 in myeloid hemopathies found in four unrelated patients. PMID:25486926
  27. EVI1 modulated the all-trans retinoic acid response of several dozens of genes. PMID:25486480
  28. EVI1 and MEL1 are homolog genes whose transcriptional activations by chromosomal translocations have roles in Japanese pediatric acute myeloid leukemia PMID:25567132
  29. We found that EVI1 and HIC1 colocalize in the nucleus, and their interaction is mediated by the amino terminal zinc finger binding domain of EVI1 PMID:24907396
  30. Findings suggest that the EVI-1 rs6774494 G > A single nucleotide polymorphism targeted by miRNA-206/133b may contribute to the pathogenesis of breast cancer. PMID:24935473
  31. Evi1-high leukemic cells themselves possess the superior potential to Evi1-low cells in oncogenic self-renewal. PMID:24747972
  32. EVI1-positive children with acute myeloid leukemia have a poor short-term prognosis PMID:24568904
  33. Co-expression of EVI1 and BCR/ABL fusion gene can be found in childhood CML and ALL. PMID:24856998
  34. Authors identify a mechanism whereby a GATA2 distal hematopoietic enhancer (G2DHE or -77-kb enhancer) is brought into close proximity to the EVI1 gene in inv(3)(q21;q26) inversions, leading to leukemogenesis. PMID:24703906
  35. 3q inversion and translocation reposition a distal GATA2 enhancer to ectopically activate EVI1 and simultaneously confer GATA2 functional haploinsufficiency, previously identified as the cause of sporadic familial acute myeloid leukemia/myelodysplastic syndrome. PMID:24703711
  36. we found that EVI1 upregulated KRAS expression through suppression of miR-96 in pancreatic cancer cells PMID:23752186
  37. EVI1 binds to DeltaNp63 promoter element directly and down regulates its expression, inducing the expression of p21 in colon carcinoma cells that do not express p53, that eventually delay cell cycle progression at G0/G1 phase. PMID:23665236
  38. Phosphorylation of the leukemic oncoprotein EVI1 on serine 196 modulates DNA binding, transcriptional repression and transforming ability. PMID:23776681
  39. The MECOM core promoter GA-repeats are also conserved in numerous species, of which human has the longest repeat and complexity. PMID:24055488
  40. Expression of EVI1 and EVI1(Del427-515) (but not EVI1(Del190-515)) in OVCAR8 ovarian cancer cells increased cyclin E1 LMW expression and cell cycle progression. PMID:23517670
  41. PR-domain protein ME has an essential role in mixed-lineage leukemia (MLL) fusion protein (MFP) leukemia PMID:24021671
  42. EVI1 oncoprotein interacts with a large and complex network of proteins and integrates signals through protein phosphorylation. PMID:23858473
  43. we identified a new locus associated with OF (rs784288 in the MECOM gene) that showed genome-wide significance (p=3.59x10(-8); OR 1.39). RNA interference revealed that a MECOM knockdown suppresses osteoclastogenesis. PMID:23349225
  44. human myeloid cell line constitutively overexpressing EVI1 was partially resistant to etoposide and daunorubicin PMID:23457546
  45. elevated EVI1 expression or in AML/MDS patients with chromosome 7 abnormalities. PMID:22887804
  46. Cell cycle analysis demonstrated EVI1's anti-proliferative effect to be strictly dose-dependent with accumulation of cells in G0/G1 PMID:23212151
  47. EVI1 binds to the promoter of miR-9-3, leading to DNA hypermethylation of the promoter and repression of miR-9. PMID:23509296
  48. Overexpression of Evi1 oncoprotein is identified as a novel mechanism by which a subset of human human colorectal cancer cells may escape TGF-beta regulation. PMID:22161860
  49. EVI1 is expressed in human hematopoietic progenitor cells, but is down-regulated during differentiation PMID:23155256
  50. Deregulated expression of EVI1 defines a subset of MLL-rearranged acute myeloid leukemias. PMID:23008312

Show More

Hide All

Subcellular Location
Nucleus. Nucleus speckle. Cytoplasm.
Database Links

HGNC: 3498

UNIGENE: Hs.744090

KEGG: hsa:2122

STRING: 9606.ENSP00000264674

OMIM: 165215

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1