Abbreviation
Recombinant Human HDAC6 protein, partial
Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
CPBHM; FLJ16239; HD 6; HD6; HDAC 6; HDAC6; HDAC6_HUMAN; Histone deacetylase 6 (HD6); Histone deacetylase 6; JM 21; JM21; KIAA0901; OTTHUMP00000032398; OTTHUMP00000197663; PPP1R90; Protein phosphatase 1 regulatory subunit 90
Species
Homo sapiens (Human)
Expression Region
1-488aa
Target Protein Sequence
MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLGQAMEEDLIVGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLIQEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNSYSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQKHRIRRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQGQGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLVLVAAGFDALQGDPKGEMAATPAGFAQLTHLLMGLAGGKLILSLEGGYNLRALAEGVSASLHTLLGDPCPMLESPGAPCRSAQASVSCALEALEPFWEVLVRSTETVERDNMEEDNVEESEEEGPWEPPVLPILTWPVLQSRTGLVYDQN
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
N-terminal 6xHis-SUMO-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Tris-based buffer,50% glycerol
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Explore the world of epigenetics and nuclear signaling with our Recombinant Human HDAC6, a highly specific histone deacetylase 6 known for its roles in chromatin remodeling, gene expression regulation, and cellular processes. As a key player in these vital mechanisms, HDAC6 is an invaluable protein for researchers seeking to elucidate the complex networks governing cell function and regulation.
Our Recombinant Human HDAC6 protein is expressed in an E. coli system, providing a partial protein sequence (1-488 amino acids). The N-terminal 6xHis-SUMO-tag allows for efficient purification and detection in a variety of experimental contexts. With a purity greater than 90% as determined by SDS-PAGE, this recombinant protein ensures consistent results and excellent performance in your research. The product is available in both liquid and lyophilized powder forms to accommodate your specific experimental requirements.