Recombinant Human HLA class II histocompatibility antigen, DR beta 3 chain (HLA-DRB3), partial

Product Details

Purity
>85% (SDS-PAGE)
Target Names
HLA-DRB3
Uniprot NO.
Alternative Names
DR beta 3 chain; DR7; DRB3_HUMAN; HLA class II histocompatibility antigen; HLA class II histocompatibility antigen DR beta 3 chain; HLA class II histocompatibility antigen DRB1 7 beta chain; HLA DR3B; HLA-DRB3; Human leucocyte antigen DRB3; Major histocompatibility complex class II DR beta 3; MGC117330; MHC class II antigen DR beta 3 chain; MHC class II antigen DRB3; MHC class II HLA DR beta 3 chain
Species
Homo sapiens (Human)
Source
Yeast
Protein Length
Partial
Tag Info
N-terminal His-tagged/Tag-Free
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews
 Q&A
Q:

We are trying to develop a multiplexing assay on Luminex to detect the HLA Class I and II antibodies in individuals.
We are looking for manufacturer who can provide us human derived recombined HLA class I and II antigens, checked on your website
and find some Locus antigens are available with you. For the panel designing we need antigens of locu DRB3.
Could you please provide some idea about it?

A:
As to your request for the antigen of DRB3, please check detailed information as follows:
We can provide all of these antigens expressed by our four expression systems: E.coli, Yeast, Baculovirus and Mammalian Cell, please check and confirm which expression system you need.
DRB3
Recombinant Human HLA class II histocompatibility antigen, DR beta 3 chain(HLA-DRB3),partial
CSB-YP302920HU >> Yeast
CSB-EP302920HU >> E.coli
CSB-BP302920HU >> Baculovirus
CSB-MP302920HU >> Mammalian cell
Expression Region:30-227aa; Partial, provide the complete extracellular domain.
Tag information:Tag type will be determined during the manufacturing process.
The expected tag for each expression system is listed as follows: YP: N-terminal 6xHis-tagged; EP, BP, MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:

GDTRPRFLELRKSECHFFNGTERVRYLDRYFHNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSALTVEWRARSESAQSK

Target Background

Function(From Uniprot)
A beta chain of antigen-presenting major histocompatibility complex class II (MHCII) molecule. In complex with the alpha chain HLA-DRA, displays antigenic peptides on professional antigen presenting cells (APCs) for recognition by alpha-beta T cell receptor (TCR) on HLA-DRB3-restricted CD4-positive T cells. This guides antigen-specific T-helper effector functions, both antibody-mediated immune response and macrophage activation, to ultimately eliminate the infectious agents and transformed cells. Typically presents extracellular peptide antigens of 10 to 30 amino acids that arise from proteolysis of endocytosed antigens in lysosomes. In the tumor microenvironment, presents antigenic peptides that are primarily generated in tumor-resident APCs likely via phagocytosis of apoptotic tumor cells or macropinocytosis of secreted tumor proteins. Presents peptides derived from intracellular proteins that are trapped in autolysosomes after macroautophagy, a mechanism especially relevant for T cell selection in the thymus and central immune tolerance. The selection of the immunodominant epitopes follows two processing modes: 'bind first, cut/trim later' for pathogen-derived antigenic peptides and 'cut first, bind later' for autoantigens/self-peptides. The anchor residue at position 1 of the peptide N-terminus, usually a large hydrophobic residue, is essential for high affinity interaction with MHCII molecules.; ALLELE DRB3*01:01: Exclusively presents several immunogenic epitopes derived from C. tetani neurotoxin tetX, playing a significant role in immune recognition and long-term protection. Presents viral epitopes derived from HHV-6B U11, TRX2/U56 and U85 antigens to polyfunctional CD4-positive T cells with cytotoxic activity implicated in control of HHV-6B infection.; ALLELE DRB3*02:02 Exclusively presents several immunogenic epitopes derived from C. tetani neurotoxin tetX, playing a significant role in immune recognition and long-term protection. Upon EBV infection, presents to CD4-positive T cells latent antigen EBNA2 (PRSPTVFYNIPPMPLPPSQL) and lytic antigen BZLF1 (LTAYHVSTAPTGSWF) peptides, driving oligoclonal expansion and selection of virus-specific memory T cell subsets with cytotoxic potential to directly eliminate virus-infected B cells. Presents viral epitopes derived from HHV-6B U11, gB/U39 and gH/U48 antigens to polyfunctional CD4-positive T cells with cytotoxic activity implicated in control of HHV-6B infection. Plays a minor role in CD4-positive T cell immune response against Dengue virus by presenting conserved peptides from capsid and non-structural NS3 proteins. Displays peptides derived from IAV matrix protein M, implying a role in protection against IAV infection. In the context of tumor immunesurveillance, may present to T-helper 1 cells an immunogenic epitope derived from tumor-associated antigen WT1 (KRYFKLSHLQMHSRKH), likely providing for effective antitumor immunity in a wide range of solid and hematological malignancies. Presents to Vbeta2-positive T-helper 1 cells specifically an immunodominant peptide derived from tumor antigen CTAG1A/NY-ESO-1(PGVLLKEFTVSGNILTIRLTAADHR) and confers protective memory response. In metastatic epithelial tumors, presents to intratumoral CD4-positive T cells a TP53 neoantigen (HYNYMCNSSCMGSMNRRPILTIITL) carrying G245S hotspot driver mutation and may mediate tumor regression.; ALLELE DRB3*03:01: Presents a series of conserved peptides derived from the M. tuberculosis PPE family of proteins, in particular PPE29 and PPE33, known to be highly immunogenic. Presents immunogenic epitopes derived from C. tetani neurotoxin tetX, playing a role in immune recognition and long-term protection. Displays immunodominant viral peptides from HCV non-structural protein NS2, as part of a broad range T-helper response to resolve infection.
Gene References into Functions
  1. In contrast to HLA-DRB4*01:01P, the inheritance of HLA-DRB3*01:01 is strongly associated with the propensity for mounting a humoral immune response against fetal HPA-1a antigen. PMID:28019029
  2. The first time that the haplotypes A33-DR3 and A33-DR9 were found with an enhanced predisposition to type 1 diabetes in Han Chinese. PMID:27181214
  3. HLA-DRB3 affects type 1 diabetes risk and islet autoantibodies. PMID:26740600
  4. this mouse model unravels a critical role for HLA-DR3 in generating an autoimmune response to SmD and lupus nephritis in the NZM2328 background. PMID:26475924
  5. Haplotyping was done on 91 Southern Europe celiac patients. HLA-DR3-DQ2 without HLA-DR7-DQ2 was present in 62.6%, HLA-DR7-DQ2 without HLA-DR3-DQ2 was present in 16.5% and HLA-DR4-DQ8 without HLA-DQ2 was present in 3.3%. PMID:24628273
  6. Children with the HLA haplotype DR3-DQ2, especially homozygotes, were found to be at high risk for celiac disease autoimmunity and celiac disease early in childhood. PMID:24988556
  7. HLA-DRB3*02:02 on the DRB1*03:01 haplotype can contribute to type 1 diabetes risk. PMID:23462545
  8. Three sets of HLA-DR3-positive haplotypes are designed that provide maximum risk of type 1 diabetes development in Indians and suggest a common Caucasian ancestor from which multiple haplotypes evolve independently. PMID:23387390
  9. Heterozygosity of HLA-DRB3*01:01 and HLA-DRB4*01:01 as a potential predictor of fetal neonatal alloimmune thrombocytopenia. PMID:22671039
  10. There was a strong sporadic inclusion body myositis association with the carriage of the DRB3*01:01 allele which was accounted for by its linkage disequilibrium with DRB1*03:01. PMID:23010279
  11. TNF associations with type 1 diabetes are caused by their linkage disequilibrium with specific HLA-DR3-DQ2 haplotypes in the Indian population. PMID:22366579
  12. In addition to confirming one of the top findings in the meta-analysis, TRIM26, RNF5 and HLA-DRB3 have been identified as potential candidate genes for schizophrenia. PMID:22433715
  13. There are no significant differences in the HLA-DRB3/B4/B5 homozygosity and heterozygosity rates between Korean males and females in both newborns and adults. PMID:22531795
  14. All patients with sporadic inclusion body myositis carried the HLA-DRB1*0301 allele, or its equivalent HLA-DR3 serological specificity PMID:21507567
  15. IA2 positivity was associated with HLA-DR4/X and HLA-DR3/4 positivity, and hypothyroidism was linked to HLA-DR4/4. PMID:20371654
  16. results suggest that DRB3 plays a significant role in antigen presentation with different epitopic preferences to DRB1. PMID:19830726
  17. HLA-DR3 is associated with anti-cyclic citrullinated peptide antibody-negative arthritis and not with anti-CCP-positive arthritis PMID:16200610
  18. HLA-DR3 alleles are associated with anti-CCP- disease and with lower levels of anti-CCP antibodies PMID:16320316
  19. The HLA-DR locus seems to be associated with the genetic susceptibility to develop SNP in Mexicans. PMID:16815190
  20. very pronounced distribution bias (P<10(-5)) of the two major DR3 conserved extended haplotypes, with DR3-B18 predominating in type 1 diabetes and DR3-B8 in celiac disease PMID:16929349
  21. German patients were distinct from Italian and North American patients with respect to DQ2 and from the North American patients with respect to B8-DR3-DQ2 HLA in autoimmune hepatitis (AIH) type 1. PMID:17006990
  22. HLA-DR and INS VNTR alleles mark both type 1 diabetes disease susceptibility and separate Caucasian parental subpopulations PMID:17052889
  23. DR3 is strongly associated with ulcerative colitis protection in a Spanish population. PMID:17714554
  24. The researchers found an association between HLA-DR3 and the presence of anti-Ro/La antibodies in patients with SLE. PMID:17910142
  25. No particular HLA-DR and DQ alleles, as well as tumor necrosis factor alpha and CTLA-4 genotypes, were associated with CAID. PMID:18223493
  26. HLA-DR3 allele may influence susceptibility to the sporadic inclusion body myositis. PMID:18258695
  27. Risk of type I diabetes in individuals with extended DR3 haplotype 8.1 is genotype-dependent, possibly associated with DPB1 and HLA class I loci. PMID:18486765
  28. T-cell responses associated with neonatal alloimmune thrombocytopenia: isolation of HPA-1a-specific, HLA-DRB3*0101-restricted CD4+ T cells PMID:19136661
  29. This study showed that significant expression of HLA-DRB3 genotypes in patients with human high-grade gliomas in Sicily. PMID:19487887
  30. interactions between Tg and discrete HLA-DR pocket signatures contribute to the initiation of autoimmune thyroid disease PMID:19776016

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein. Endoplasmic reticulum membrane; Single-pass type I membrane protein. Lysosome membrane; Single-pass type I membrane protein. Late endosome membrane; Single-pass type I membrane protein. Autolysosome membrane; Single-pass type I membrane protein.
Protein Families
MHC class II family
Tissue Specificity
Expressed in professional APCs: monocyte/macrophages, dendritic cells and B cells (at protein level).
Database Links

HGNC: 4951

UNIGENE: Hs.696211

KEGG: hsa:3125

OMIM: 612735

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1