Home
Product
Protein
Recombinant Proteins
Recombinant Human HLA class II histocompatibility antigen, DM beta chain (HLA-DMB),partial

Recombinant Human HLA class II histocompatibility antigen, DM beta chain (HLA-DMB),partial

In Stock

Code: CSB-EP333326HUc7

Rate （N/A）
Review （0）

Size:

20ug100ug1mg

US$388

Quantity:

Express system: E.coli

Species: Homo sapiens (Human)

Tag Info: C-terminal 6xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Abbreviation

Recombinant Human HLA-DMB protein, partial

Purity

Greater than 95% as determined by SDS-PAGE.

Target Names

HLA-DMB

Uniprot NO.

P28068

Research Area

Immunology

Alternative Names

MHC class II antigen DMB;Really interesting new gene 7 protein

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

19-218aa

Target Protein Sequence

GGFVAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTREPVMLACYVWGFYPAEVTITWRKNGKLVMPHSSAHKTAQPNGDWTYQTLSHLALTPSYGDTYTCVVEHIGAPEPILRDWTPGLSPMQTLK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

29.3 kDa

Protein Length

Partial

Tag Info

C-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.190.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

Target Background

Function(From Uniprot)

Plays a critical role in catalyzing the release of class II-associated invariant chain peptide (CLIP) from newly synthesized MHC class II molecules and freeing the peptide binding site for acquisition of antigenic peptides. In B-cells, the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO.

Gene References into Functions

This study provides novel insights into how HLA-DM efficiently catalyzes peptide loading during antigen presentation. PMID:26062997
Data suggest that antigen processing by MHC class II HLA-DMB antigen is a target pathway in the pathogenesis of HIV-related Kaposi's sarcoma. PMID:25008864
Overexpression of HLA-DM at the plasma membrane of dendritic cells improves quantitatively, but also qualitatively, the presentation of CD4-expressing T cell epitopes in cellular vaccine therapies for cancer. PMID:21622867
HLA-DM mediates a noncooperative release of prebound influenza virus hemagglutinin peptides from wild-type HLA-DR1 by destabilizing the beta81 hydrogen (H-)bond, since a similar phenomenon is observed when this H-bond is absent. PMID:20038641
HLA-DMB may play an important role in pathogenesis of type 1 diabetes, and clinical status heterogeneity of type 1 diabetes may be related to genetic mechanism. PMID:14754527
findings suggest HLA-DM expression in antigen presenting cells controls class II-mediated type II collagen(261-273) peptide/epitope presentation & regulates CD4+ T cell responses to this self epitope, potentially influencing CII-dependent autoimmunity PMID:18506881
Tumor cell expression of HLA-DMB is associated with increased numbers of tumor-infiltrating CD8 T lymphocytes and both are associated with improved survival in advanced-stage serous ovarian cancer. PMID:19047092
No individual component of conserved HLA-DM hydrogen bond network demonstrates an essential role in the DM catalytic mechanism. Catalytic potency of HLA-DM with each beta-chain mutant was equal to or greater than that observed with wild-type HLA-DR1. PMID:19767569

Hide All

Subcellular Location

Late endosome membrane; Single-pass type I membrane protein. Lysosome membrane; Single-pass type I membrane protein. Note=Localizes to late endocytic compartment. Associates with lysosome membranes.

Protein Families

MHC class II family

Database Links

HGNC: 4935

UNIGENE: Hs.351279

KEGG: hsa:3109

STRING: 9606.ENSP00000398890

OMIM: 142856

Promotions