Recombinant Human HLA class I histocompatibility antigen, alpha chain G (HLA-G),Partial

In Stock
Code: CSB-EP010509HU1
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$224
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: N-terminal 6xHis-SUMO-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
HLA-G
Uniprot NO.
Research Area
Immunology
Alternative Names
HLA G antigen MHC class I antigen G
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
25-308aa
Target Protein Sequence
GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
48.7kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-SUMO-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews
 Q&A
Q:

I would like to know the in vitro activity of this product. Does this product show the biological activity when added into culture ?

A:
Thanks for your inquiry.
We haven't tested the activity of this protein, and cannot 100% guaranteed. What we provide is the full length of mature protein, and it is purified under mild condition. It should be active in theory.

Target Background

Function(From Uniprot)
Non-classical major histocompatibility class Ib molecule involved in immune regulatory processes at the maternal-fetal interface. In complex with B2M/beta-2 microglobulin binds a limited repertoire of nonamer self-peptides derived from intracellular proteins including histones and ribosomal proteins. Peptide-bound HLA-G-B2M complex acts as a ligand for inhibitory/activating KIR2DL4, LILRB1 and LILRB2 receptors on uterine immune cells to promote fetal development while maintaining maternal-fetal tolerance. Upon interaction with KIR2DL4 and LILRB1 receptors on decidual NK cells, it triggers NK cell senescence-associated secretory phenotype as a molecular switch to promote vascular remodeling and fetal growth in early pregnancy. Through interaction with KIR2DL4 receptor on decidual macrophages induces proinflammatory cytokine production mainly associated with tissue remodeling. Through interaction with LILRB2 receptor triggers differentiation of type 1 regulatory T cells and myeloid-derived suppressor cells, both of which actively maintain maternal-fetal tolerance. May play a role in balancing tolerance and antiviral-immunity at maternal-fetal interface by keeping in check the effector functions of NK, CD8+ T cells and B cells. Reprograms B cells toward an immune suppressive phenotype via LILRB1. May induce immune activation/suppression via intercellular membrane transfer (trogocytosis), likely enabling interaction with KIR2DL4, which resides mostly in endosomes. Through interaction with the inhibitory receptor CD160 on endothelial cells may control angiogenesis in immune privileged sites.; Likely does not bind B2M and presents peptides. Negatively regulates NK cell- and CD8+ T cell-mediated cytotoxicity.; Likely does not bind B2M and presents peptides. Negatively regulates NK cell- and CD8+ T cell-mediated cytotoxicity.; Likely does not bind B2M and presents peptides. Negatively regulates NK cell- and CD8+ T cell-mediated cytotoxicity.; Non-classical major histocompatibility class Ib molecule involved in immune regulatory processes at the maternal-fetal interface. In complex with B2M/beta-2 microglobulin binds a limited repertoire of nonamer self-peptides derived from intracellular proteins including histones and ribosomal proteins. Peptide-bound HLA-G-B2M complex acts as a ligand for inhibitory/activating KIR2DL4, LILRB1 and LILRB2 receptors on uterine immune cells to promote fetal development while maintaining maternal-fetal tolerance. Upon interaction with KIR2DL4 and LILRB1 receptors on decidual NK cells, it triggers NK cell senescence-associated secretory phenotype as a molecular switch to promote vascular remodeling and fetal growth in early pregnancy. Through interaction with KIR2DL4 receptor on decidual macrophages induces proinflammatory cytokine production mainly associated with tissue remodeling. Through interaction with LILRB2 receptor triggers differentiation of type 1 regulatory T cells and myeloid-derived suppressor cells, both of which actively maintain maternal-fetal tolerance. Reprograms B cells toward an immune suppressive phenotype via LILRB1.; Likely does not bind B2M and presents peptides.; Likely does not bind B2M and presents peptides.
Gene References into Functions
  1. HLA-G, NRP1, and PD-1, may be involved in the immune response in psoriatic patients PMID:29790686
  2. Considering that others 14-bp associations were inconclusive and that other variation sites observed at HLA-G 3'UTR exhibit a proven role on post-transcriptional regulation of HLA-G expression, the complete 3'UTR segment should be analyzed in terms of disease susceptibility, instead of a single polymorphism. PMID:30102938
  3. study demonstrated that HLA-G 14-bp Ins/Del polymorphism may exert no influence on susceptibility to viruses - Meta-analysis PMID:30235670
  4. The findings indicate that GPER/miR148a/HLAG signaling pathway may mediates the development of ovarian endometriosis and may become a potential therapeutic target for the treatment of endometriosis. PMID:29845209
  5. Significantly different distribution of HLA-G polymorphism (rs1611715), but not the serum level of sHLA-G, were found between multiple sclerosis patients and healthy individuals. PMID:29924453
  6. These results indicate the importance of the HLA-G promoter SNPs in the pregnancy outcome. But to reach a more definite conclusion, subsequent studies on 3' UTR and other positions with polymorphism in the 5' UTR regions larger samples are necessary. PMID:29797531
  7. HLA-G expression is associated with poor survival in stage III gastric cancer patients and represents a possible immunoescape mechanism of cancer cells. PMID:29845360
  8. this study shows that HLA-G molecules have a role in predicting the newborn's likelihood for oral HPV infection at birth. PMID:29544814
  9. HLA-G is highly represented in ovarian carcinoma suggesting a potential association with progressive disease mechanism PMID:29499226
  10. this study shows that HLA-G is expressed in intestinal samples of ulcerative colitis and Crohn's disease patients PMID:29588183
  11. this study shows that HLA-G mediated immune regulation is impaired by a single amino acid exchange in the alpha 2 domain PMID:29605689
  12. No significant differences in single nucleotide polymorphisms in the 3' untranslated region of HLA-G in placentas between spontaneous preterm birth and preeclampsia. PMID:29540242
  13. the HLA-G 14bp ins/del gene polymorphism is an important risk factor for the incidence and poor outcome of NHL cases. PMID:29388862
  14. these findings showed that HLA-G overexpression in tumor tissue correlated with poor prognosis in pancreatic adenocarcinoma PMID:29549230
  15. This meta-analysis suggested that the HLA-G 14-bp insertion allele may increase the risk of recurrent implantation failure in Caucasians. PMID:28707147
  16. Study shows that HLA-G alleles are skewed in autism spectrum disorder (ASD) children. HLA-G alleles seen in ASD result in immune activation. The skewing of HLA-G alleles seen in ASD might play a pathogenic role. PMID:28923404
  17. these data confirm an important role of HLA-G 3'UTR polymorphisms in the development of severe forms of sepsis in Brazil PMID:28941746
  18. a 14bp indel in HLA-G associated with increased flow-mediated dilatation of the brachial artery in renal transplant recipients PMID:28987961
  19. the maternal HLA-G 14-bp Ins/Del polymorphism is not associated with preeclampsia risk. PMID:29105301
  20. the HLA-G 14-bp Ins/Del polymorphism may be a marker for genetic susceptibility to chronic hepatitis B infection. PMID:28929613
  21. The presence of the HLA-G +3142 CC genotype was associated with higher susceptibility to CMV infection after kidney transplantation. PMID:29113092
  22. The results from the study suggest a possible involvement of HLA-G in the risk modulation toward hepatitis C virus infection. PMID:28083985
  23. our results suggest that elevated levels of HLA- G expression, precisely sHLA- G1 homodimers, are indeed associated with persistent infection with HBV. sHLA- G (sHLA- G1 and HLA- G5 both) levels may be a prognostic indicator for spontaneous recov-ery. PMID:28429836
  24. Results show that HLA-G rs1233334:CT protected against progression of endometriosis. PMID:29234882
  25. The results suggest that HLA-G polymorphism has small effect on systemic lupus erythematosus susceptibility and that soluble HLA-G may be involved in the pathogenesis of the disease. PMID:28695673
  26. sHLA-G levels is an independent prognosis factor and improves the prognostic stratification offered by traditional prognosticators in CRC patients. PMID:28415627
  27. we found a significant association between HLA-G rs1063320 (thorn3142G>C) and 14-bp ins/del variants and risk of recurrent spontaneous abortion. PMID:28600033
  28. HLA-G del/del genotypes were more frequent among mothers with gestational diabetes than in control. Babies carrying HLA-G del/del showed the highest sHLA-G levels. PMID:28655969
  29. No statistically significant differences in either HLA-G allele or genotype frequencies between pre-eclampsia cases and control group have been observed. PMID:29061057
  30. Overexpressed HLA-G revealed their ability to inhibit the cell proliferation and cytotoxic activity of NK-92MI cells, and reduce the secretion of IFN-gamma and TNF-alpha through immunoglobulin-like transcript 2. PMID:29224003
  31. Soluble HLA-G was significantly higher in the persistent wheezing (positive modified asthma predictive index) infant group compared with the transient wheezing (negative modified asthma predictive index) group (P = 0.008). PMID:27880031
  32. this study shows associations between fetal HLA-G genotype and birth weight and placental weight in a large cohort of pregnant women PMID:28267635
  33. evidence is presented that HLA-G1 monomer exhibits the therapeutic effects on atopic dermatitis-like skin lesions in mice PMID:28675838
  34. this study shows that HLA-G is expressed by ARPE-19 retinal pigment epithelium cells and is upregulated as a response to pro-inflammatory cytokines PMID:28442288
  35. Cellular activation and pathological processes are associated with an aberrant or a neo-expression of HLA-G/soluble HLA-G. (Review) PMID:27440734
  36. the +3142 C>G, but not the 14bp INS/DEL polymorphism may constitute a genetic susceptibility factor to multiple sclerosis in the Tunisian population. PMID:27771469
  37. novel HLA-G-regulating miRs, miR-628-5p and miR-548q, were identified in renal cell carcinoma PMID:27057628
  38. high expression of total soluble HLA-G and vesicular soluble HLA-G, together with the presence of the 14-bp deletion allele, might be involved in implantation failure PMID:26959830
  39. the presented data suggest that the investigated HLA-G*0105N allele is potentially associated with recurrent spontaneous abortions through linkage disequilibrium with other genetic elements. PMID:26754761
  40. these findings demonstrate the association of HLA-G polymorphism with breast cancer susceptibility in Tunisian population PMID:26754763
  41. results strongly suggest the involvement of HLA-G in human African trypanosomiasis disease progression PMID:27470243
  42. women with preterm premature rupture of membranes had significantly higher serum and vaginal sHLA-G concentrations compared to controls PMID:27232355
  43. Serum levels of soluble HLA-G were similar in CMV- and CMV+ subjects but levels in culture supernatants were significantly higher in cells from CMV+ than from CMV- subjects stimulated with CMV antigens. The HLA-G ligand KIR2DL4 was mainly expressed on NK cells and CD56+ T cells with no differences between CMV+ and CMV- subjects. PMID:28817184
  44. our study is the first to suggest that HLA-G expression may influence the clinical outcome of chronic myeloid leukemia PMID:28841441
  45. SV40 immune-inhibitory direct effect and the presence of high levels of the immune-inhibitory HLA-G molecules could co-operate in impairing B lymphocyte activation towards SV40 specific peptides. PMID:27443345
  46. HLA-G 3'UTR polymorphisms associated with a greater magnitude of HLA-G production were associated with differentiated thyroid tumours and with variables implicated in poor prognosis. PMID:27914217
  47. The inhibitory properties of bronchial endothelial cellss are dysregulated in stable lung transplant recipients via TGF-beta, IL-10 and HLA-G signaling pathway. PMID:27820781
  48. HLA-G expression was upregulated in chondrocyte-differentiated mesenchymal stem cells under hypoxia context and could be boosted in allogenic settings. PMID:27465875
  49. this review provides new insights into the mechanisms controlling the expression and function of HLA-G at the maternal-fetal interface, and discuss their relevance for fetal tolerance PMID:28279591
  50. we propose a massively parallel sequencing (NGS) with a bioinformatics strategy to evaluate the entire HLA-G regulatory and coding segments PMID:28135606

Show More

Hide All

Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein. Endoplasmic reticulum membrane. Early endosome membrane.; [Soluble HLA class I histocompatibility antigen, alpha chain G]: Secreted.; [Isoform 2]: Cell membrane; Single-pass type I membrane protein.; [Isoform 3]: Cell membrane; Single-pass type I membrane protein.; [Isoform 4]: Cell membrane; Single-pass type I membrane protein.; [Isoform 5]: Secreted. Early endosome.; [Isoform 6]: Secreted.; [Isoform 7]: Secreted.; Cell projection, filopodium membrane.
Protein Families
MHC class I family
Tissue Specificity
Expressed in adult eye. Expressed in immune cell subsets including monocytes, myeloid and plasmacytoid dendritic cells and regulatory T cells (Tr1)(at protein level). Secreted by follicular dendritic cell and follicular helper T cells. Isoform 5: Detected
Database Links

HGNC: 4964

UNIGENE: Hs.512152

KEGG: hsa:3135

STRING: 9606.ENSP00000353472

OMIM: 142871

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products