Recombinant Human HLA-C protein (HLA-C), partial

In Stock

Code: CSB-RP150994h

Rate （N/A）
Review （0）

Size:

20ug100ug1mg(1mg*1 or 500ug*2)

US$224

Quantity:

Express system: E.coli

Tag Info: N-terminal 6xHis-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Uniprot NO.

O78179

Research Area

Immunology

Source

E.coli

Expression Region

25-308aa

Target Protein Sequence

CSHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQWMYGCDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAARAAEQQRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHLVSDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLTLRWEPSSQPTIPI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

36.7kDa

Protein Length

Partial

Tag Info

N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Description

Recombinant Human HLA-C protein is a prokaryotic system E.coli expressed Partial protein. To make this HLA-C recombinant protein, the HLA-C gene is synthesized and cloned into the E.coli system expression vector, and then it was transformed into protein-expressing host E Coli for expression, the other steps are testing for the identification of recombinant protein, large scale production and target protein Isolation and purification. The purity of the final HLA-C protein is 90%+ as determined by SDS-PAGE.

HLA-C belongs to the HLA class I heavy chain receptors in human. This protein is a heterodimer consisting of a HLA-C mature gene product (a heavy chain) and a light chain (β2-microglobulin). The heavy chain is anchored in the membrane. MHC Class I molecules, like HLA-C present small peptides to the immune system, allowing cytotoxic T lymphocytes to bind to mature HLA cell surface proteins via the antigen-binding groove. Class I genes mainly bind antigens to Presented to CD8+ T cells, class II genes primarily present antigens to CD4+ T cells.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

■ Q&A

We are trying to develop a multiplexing assay on Luminex to detect the HLA Class I and II antibodies in individuals.
We are looking for manufacturer who can provide us human derived recombined HLA class I and II antigens, checked on your website and find some Locus antigens are available with you. For the panel designing we need antigens of locu C.
Could you please provide some idea about it?

As to your request for the antigen of C, please check detailed information as follows:
Recombinant Human HLA-C protein(HLA-C),partial
CSB-RP150994h
Expression Region:25-308aa; Partial.
Tag information:N-terminal 6xHis-tagged
Sequence: