Abbreviation
Recombinant Human MSTN protein (Active)
Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human MSTN(GDF-8) at 2 μg/mL can bind Human ACVR2B (CSB-MP623829HUi9). The EC50 is 68.26-74.59 ng/mL.
Alternative Names
Growth/differentiation factor 8; GDF-8; Myostatin; MSTN; GDF8
Species
Homo sapiens (Human)
Expression Region
24-375aa
Target Protein Sequence
NENSEQKENVEKEGLCNACTWRQNTKSSRIEAIKIQILSKLRLETAPNISKDVIRQLLPKAPPLRELIDQYDVQRDDSSDGSLEDDDYHATTETIITMPTESDFLMQVDGKPKCCFFKFSSKIQYNKVVKAQLWIYLRPVETPTTVFVQILRLIKPMKDGTRYTGIRSLKLDMNPGTGIWQSIDVKTVLQNWLKQPESNLGIEIKALDENGHDLAVTFPGPGEDGLNPFLEVKVTDTPKRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human MSTN(GDF-8) at 2 μg/ml can bind Human ACVR2B (CSB-MP623829HUi9). The EC50 is 68.26-74.59 ng/mL.
Description
Myostatin is a negative regulator of skeletal muscle mass, making it a critical target for understanding muscle wasting, cachexia, and regenerative pathways. This full-length human protein (aa 24–375) demonstrates specific receptor engagement, binding human ACVR2B with an EC50 of 68.26–74.59 ng/mL in functional ELISA, a potency range that supports receptor-ligand competition assays and antibody characterization studies where quantitative binding kinetics are essential. Mammalian expression preserves native post-translational modifications, aligning with standards expected in cell-based differentiation models and in vivo muscle biology experiments. Purity exceeding 95% by SDS-PAGE and endotoxin below 1.0 EU/μg meet the quality thresholds commonly required for stem cell differentiation assays and primary myoblast culture systems, where contaminants can confound proliferation and myogenic commitment readouts.
-SDS.jpg)
-AC1.jpg)
