Recombinant Human Glycophorin-A (GYPA), partial

Code
MSDS
Size Pls inquire
Source
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
GYPA
Uniprot NO.
Alternative Names
Glycophorin-A; MN sialoglycoprotein; PAS-2; Sialoglycoprotein alpha; CD antigen CD235a; GYPA GPA MNS
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
20-91
Target Protein Sequence
LSTTEVAMHTSTSSSVTKSYISSQTNDTHKRDTYAATPRAHEVSEISVRTVYPPEEETGERVQLAHHFSEPE
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
Form
Liquid or Lyophilized powder
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function
Glycophorin A is the major intrinsic membrane protein of the erythrocyte. The N-terminal glycosylated segment, which lies outside the erythrocyte membrane, has MN blood group receptors. Appears to be important for the function of SLC4A1 and is required for high activity of SLC4A1. May be involved in translocation of SLC4A1 to the plasma membrane. Is a receptor for influenza virus. Is a receptor for Plasmodium falciparum erythrocyte-binding antigen 175 (EBA-175); binding of EBA-175 is dependent on sialic acid residues of the O-linked glycans. Appears to be a receptor for Hepatitis A virus (HAV).
Gene References into Functions
  1. Cell viability and surface expression of transferrin receptor (CD71) and glycophorin A (GPA) were analyzed before and after re-culture by flow cytometry. These studies show differential sensitivities of these surface proteins on K562 cells to proteases, and suggest molecular mechanisms of transmembrane protein transport and cycling. PMID:28980921
  2. a complex structural rearrangement involving the loss of GYPB and gain of two GYPB-A hybrid genes reduces the risk of severe malaria by 40% and has recently increased in frequency in parts of Kenya PMID:28522690
  3. The authors show that Plasmodium falciparum EBA-175 mediates substantial changes in the deformability of erythrocytes by binding to glycophorin A and activating a phosphorylation cascade that includes erythrocyte cytoskeletal proteins resulting in changes in the viscoelastic properties of the host cell. PMID:28226242
  4. While weak interactions between glycophorin and band 3 undoubtedly exist, glycophorin A and band 3 must have separate interactions in the membrane that control their lateral mobility. PMID:27580023
  5. CD235a could be the most sensitive predictor similar to CD4. PMID:25716234
  6. Glycophorin-A-rich microparticles are released from evolving growing thrombi into the distal perfusing blood, and can be measured in peripheral blood. CD235a(+) cMPs may constitute a novel systemic biomarker of ongoing thrombosis. PMID:26239059
  7. The authors demonstrate that the initial vacuolar membrane around internalized Babesia divergens is formed from protein and lipid components of the red blood cells plasma membrane, including band 3, glycophorin A and spectrin. PMID:25628009
  8. GPA-deficient band 3 null erythrocytes are resistant to malaria infection. PMID:25778531
  9. MNSs blood group glycophorin variants in Taiwan: a genotype-serotype correlation study of 'Mi(a)' and St(a) with report of two new alleles for St(a). PMID:24858913
  10. PfEBA-175 engages multiple glycans of GpA encoded by exon 3 and that the presentation of glycans is likely required for high-avidity binding. PMID:25205096
  11. The expression of glycophorin A and osteoprotegerin is locally increased in carotid atherosclerotic lesions of symptomatic compared to asymptomatic patients. PMID:23722820
  12. These data demonstrate the importance of PfEBA175 regions other than the DBL domains in the interaction with GYPA and merit their inclusion in an EBA175-based vaccine. PMID:24043627
  13. GPA-NN mutagens contributed to the pathogenesis of chronic benzene poisoning. PMID:17456399
  14. Beta-branched residues adjacent to GG4 motifs promote the efficient association of glycophorin A transmembrane helices. PMID:21072853
  15. Data suggest that glycophorin A (Gpa) increases expression and activity of Cl-/HCO3- exchanger Ae1, that G719D mutation renders Ae1 mutant constructs GPA-unresponsive, and suggests a role for Ae1 amino acids 22-28 in GPA responsiveness. PMID:21455273
  16. the GG genotype of the rs 1489759 HHIP single-nucleotide polymorphism (SNP) and the CC genotype of the rs 2202507 GYPA SNP confers a ''protective'' effect on COPD (OR 0.59, p50.006 for HHIP and OR50.65, p50.006 for GYPA) and lung cancer. PMID:21119205
  17. Data indicate that changes of the glycophorin A dimerization propensities in different lipid bilayers suggest that the lipid bilayer thickness severely influences the monomer-dimer equilibrium of the transmembrane domain. PMID:20603102
  18. ABH blood group antigens in N-glycan of human glycophorin A. PMID:20434428
  19. The Sta gene found in this family has A246 & C252, C302, and G307. The putative crossing-over point is between nucleotides 252 to 302 in Intron 3. PMID:20233359
  20. Energy transfer between differently labelled glycophorin A transmembrane helices decreased with increasing Sodium Dodecyl Sulfate mole fractions albeit without modifying the helicity of the peptides. PMID:20074546
  21. Heterozygous missense mutation E758K in the human AE1/SLC4A1/band 3 gene in two unrelated patients with well-compensated hereditary spherostomatocytic anemia induces glycophorin A-independent, endogenous cation transport. PMID:19907019
  22. Natural selection of polymorphisms/variants on the erythrocyte surface PMID:11861881
  23. Somatic cell mutations found at the gene locus in erythrocytes of radiation workers at a nuclear facility PMID:12492375
  24. Distinct regions of human glycophorin A enhance human red cell anion exchanger transport function and surface trafficking PMID:12813056
  25. band 3 in the red cell can take up two different structures: one with high anion transport activity when glycophorin A is present and one with lower anion transport activity when glycophorin A is absent PMID:14604989
  26. Porcine Kupffer cells bind xenogeneic human RBC by recognition of a carbohydrate epitope on glycophorin A. PMID:16003235
  27. This study demonstrates the systematic classification of ten alleles (five M and five N alleles) of the MN blood group system to major or minor variations of the standard alleles. PMID:16205834
  28. glycophorin A somatic mutation frequency levels in newborns are not related to maternal lifestyle factors or drug metabolizing enzyme genotypes PMID:16424825
  29. GYPA & GYPB genotypes carrying MNSs antigens were analyzed in Thai patients with cerebral malaria & mild malaria; no statistical difference was found; it is concluded that MNSs antigens do not reveal the difference in susceptibility to cerebral malaria PMID:17372674
  30. single mutations in glycophorin A can result in the observed fourth power relationship with age of oncet in polycythemia rubra vera PMID:17452518
  31. GPA depletion does not alter band 3's native conformation at the DIDS binding site. It modulates a conformational equilibrium between 2 states of the binary complex formed by the competitive inhibitor DIDS, reversibly bound to properly folded band 3. PMID:19071041
  32. AE1 and GPA form a complex in the endoplasmic reticulum of human K562 cells. PMID:19438409

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein. Note=Appears to be colocalized with SLC4A1.
Protein Families
Glycophorin A family
Database Links

HGNC: 4702

UNIGENE: Hs.434973

KEGG: hsa:2993

STRING: 9606.ENSP00000354003

OMIM: 111300

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1