Recombinant Human Glutamate receptor ionotropic, NMDA 1 (GRIN1), partial

In Stock
Code: CSB-EP009911HU1
Size:
20μg
20μg100μg1mg(1mg*1 or 500ug*2)
US$388
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: N-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
GRIN1
Uniprot NO.
Research Area
Neuroscience
Alternative Names
GluN1; Glutamate [NMDA] receptor subunit zeta-1; Glutamate receptor ionotropic N methyl D aspartate 1; Glutamate receptor ionotropic, N-methyl-D aspartate, subunit 1; glutamate receptor ionotropic, NMDA 1; Grin1; MRD8; N methyl D aspartate receptor; N methyl D aspartate receptor channel subunit zeta 1; N methyl D aspartate receptor subunit NR1; N-methyl-D-aspartate receptor subunit NR1; NMD-R1; NMDA 1; NMDA R1; NMDA receptor 1; NMDA1; NMDAR; NMDZ1_HUMAN; NR1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
834-938aa
Target Protein Sequence
EIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDTSTGGGRGALQNQKDTVLPRRAIEREEGQLQLCSRHRES
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
18.0 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Component of NMDA receptor complexes that function as heterotetrameric, ligand-gated ion channels with high calcium permeability and voltage-dependent sensitivity to magnesium. Channel activation requires binding of the neurotransmitter glutamate to the epsilon subunit, glycine binding to the zeta subunit, plus membrane depolarization to eliminate channel inhibition by Mg(2+). Sensitivity to glutamate and channel kinetics depend on the subunit composition.
Gene References into Functions
  1. Glycans potentiate the effect of GluN1 and GluN2B receptors. PMID:28378791
  2. In this study, we report a success of the WES approach to the identification of a genetic cause of a challenging case, undiagnosed on clinical grounds. We identified the causative missense mutation (p.Met727Val) in exon 16 of the GRIN1 gene. As the p.Met727Val mutation shown by WES is in the same GluN1 domain, we infer that the pathogenic variant impact on NMDAR is likely similar to that induced by p.Glu662Lys mutation. PMID:29194067
  3. one base difference in the GRIN1M promoter sequence (G --> C) results in the inability of the sequence to form a parallel G-quadruplex. PMID:28702665
  4. Data suggest GRINL1A (GCOM1)-NMDA receptor-internexin-alpha (INA) interaction pathway may be relevant to neuroprotection. PMID:29339073
  5. These results indicate these individuals may have suffered neurodevelopmental deficits as a result of the decreased presence of GluN1-G620R/GluN2B complexes on the neuronal surface during embryonic brain development and reduced current responses of GluN1-G620R-containing NMDARs after birth. PMID:28228639
  6. Mice with GRIN1 disrupted in the intralaminar thalamic nuclei exhibited various schizophrenia-like phenotypes, including deficits in working memory, long-term spatial memory, and attention, as well as impulsivity, impaired prepulse inhibition, hyperlocomotion and hyperarousal. PMID:28244984
  7. 2-methoxyestradiol impacts on glycine/serine-mediated metabolic reprogramming in osteosarcoma cells by its interaction with GRIN1/GluN2A receptors. PMID:28262924
  8. tPA is a ligand of the N-terminal domain of the obligatory GluN1 subunit of NMDAR acting as a modulator of their dynamic distribution at the neuronal surface and subsequent signaling. PMID:27831563
  9. Two novel Grin1 mutations were identified in 2 cases of severe early infantile encephalopathy. Se688Tyr mutation results in disruption of NMDA ligand binding and the p.Gly827Arg mutation results in disrupted gating of the ion channel. PMID:28389307
  10. A homozygous missense variant of GRIN1 was identified in two consanguineous sibs affected with severe intellectual disability and autistic features. PMID:28051072
  11. NMDA receptor-dependent signaling is involved in melanosome transfer, which is associated with calcium influx, cytoskeleton protein redistribution, dendrites and filopodia formation PMID:27596138
  12. Findings show that N-methyl-d-aspartic acid receptor subunit GluN1 is expressed on oligodendrocytes and myelin in humans. PMID:27443784
  13. De novo GRIN1 mutations are associated with severe intellectual disability with cortical visual impairment as well as oculomotor and movement disorders being discriminating phenotypic features. Loss of NMDA receptor function appears to be the underlying disease mechanism. The identification of both heterozygous and homozygous mutations blurs the borders of dominant and recessive inheritance of GRIN1-associated disorders. PMID:27164704
  14. The differences in cortical NMDAR expression and post-synaptic density protein 95 are present in psychiatric disorders and suicide completion and may contribute to different responses to ketamine. PMID:26013316
  15. GRIN1 (rs4880213) was significantly associated with depression and disruptive behavior in adolescents. PMID:26819771
  16. Knockdown of PKD1 did not affect NMDAR internalization but prevented the phosphorylation and inhibition of remaining surface NMDARs and NMDAR-mediated synaptic functions. PMID:26584860
  17. Study found GluN receptor subunit-specific changes in mixed subcortical ischemic vascular dementia(SIVD)/Alzheimer's disease(AD) (decreased GluN1) and SIVD (increased GluN2A and 2B), likely reflecting interaction of ischemic neurovascular and AD processes PMID:25261450
  18. results suggest that NMDA-R autoantibodies are unlikely to account for a large proportion of treatment-refractory psychosis. PMID:25431428
  19. The results of this study suggested that GRIN1 mutations cause encephalopathy resulting in seizures and movement disorders. PMID:25864721
  20. Genome-wide significant marker, SNP rs524991, and an association of seropositivity with influenza autoantibodies status, we provide genetic and environmental risk factors of NMDAR-autoantibodies formation PMID:23999527
  21. Epigenetic changes in GRIN1, in combination with experiences of maltreatment, may confer risk for depression in children. PMID:24655651
  22. Reduction in NR1 and NR2C in the DLPFC of people with schizophrenia may lead to altered NMDAR stoichiometry and provides compelling evidence for an endogenous NMDAR deficit in schizophrenia. PMID:23070074
  23. Isolated GluN1/GluN3A receptors integrated into lipid bilayers responded to addition of either glycine or d-serine, but not glutamate, with a approximately 1 nm reduction in height of the extracellular domain PMID:25017909
  24. Results show that the expression and distribution of NMDA receptors subunits GluN1, GluN2A and GluN2B - together with that of postsynaptic protein PSD-95 - are modified in Alzheimer's disease compared to normal aging PMID:24156266
  25. B7T inhibition of NMDA current mediated by NR1/NR2B receptor. PMID:23271275
  26. The rs1126442, GRIN1 polymorphism contributes to the genetic vulnerability to psychosis in METH-dependent subjects in the Thai population. PMID:23880023
  27. Association of multiple sclerosis disease severity and allelic variants of the NR1 and NR2B glutamate receptor genes. PMID:23840674
  28. GluN1 binds specifically to the sigma-1 receptor within intact cells. PMID:24227730
  29. Antibodies that bind recombinant GluN1-S2 peptides (but not the intact GluN1 protein) develop transiently in patients after stroke in proportion to infarct size, suggesting that these antibodies are raised secondarily to neuronal damage. PMID:23723305
  30. Transgenic NR1 receptors on neuradrenergic neurons regulate development of opiate dependence and psychomotor sensitization. PMID:22040728
  31. After 7 days of chronic alcohol exposure, there are significant increases in mRNA expression of GRIN1 in cultured neurons derived from alcoholic subjects, but not in cultures from nonalcoholics. PMID:22486492
  32. Adult NR1-deficient transgenic mice show multiple abnormal behaviors including reduced social interactions, locomotor hyperactivity, self-injury, deficits in prepulse inhibition and sensory hypersensitivity, among others. PMID:22726567
  33. GRIN1 and GRIN2D appear instrumental to normal brain development and function in this study of rare and/or de novo mutation in neurodevelopmental disorders. PMID:22833210
  34. The multifunctional cytokine-like molecule HMGB1 released by activated, stressed, and damaged or necrotic cells can facilitate NMDAR-mediated cell responses. PMID:22952988
  35. A critical role of the single glutamine residue within the GluN1 M4 domain regulates surface delivery of functional NMDA receptors. PMID:22937865
  36. key amino acid residues within both NR1 and NR2B M3 domains contribute to the regulation of the surface expression of unassembled NR1 and NR2 subunits PMID:22711533
  37. The unique co-existence of SP and phospho-NMDAR1 in tendinopathy presumably reflects a tissue proliferative and nociceptive role. PMID:22354721
  38. GluN1(hypo) transgenic mice exhibit impairments on all tests of cognition that are employed, as well as reduced engagement in naturalistic behaviors, including nesting and burrowing. PMID:22300668
  39. The NR1 subunit of NMDA receptors is involved in amygdala hyperexcitability in some patients who have temporal lobe epilepsy. PMID:20848605
  40. G Protein-regulated inducer of neurite outgrowth (GRIN) modulates Sprouty protein repression of mitogen-activated protein kinase (MAPK) activation by growth factor stimulation PMID:22383529
  41. Transgenic mice with dopaminergic neuron-specific NMDAR1 deletion are impaired in a variety of habit-learning tasks, while normal in some other dopamine-modulated functions such as locomotor activities. PMID:22196339
  42. Homozygotes for the T allele in the rs4880213 GRIN1 SNP had reduced intracortical inhibition, as expected for enhanced glutamatergic excitation in these subjects. PMID:21753020
  43. NMDAR1 subunit expressed by primary afferent nerves of floxed mice plays an important role in the development of sensitized pain states. PMID:20974228
  44. Expression of NMDA receptors in lymphocytes is regulated by central nervous system, which controls the inflammation process. PMID:20414717
  45. The results of this study suggested that haplotypes of GRIN1 may influence responsiveness to ACTH. PMID:20722663
  46. Sp4 hypomorphic mice could therefore serve as a genetic model to investigate impaired NMDA functions resulting from loss-of-function mutations of human SP4 gene in schizophrenia and/or other psychiatric disorders. PMID:20634195
  47. Both tissue-type PA (tPA) and urokinase-type PA (uPA) bind to NMDA-R1 and reverse this effect, thereby enhancing acetylcholine-induced tracheal contractility. PMID:20097831
  48. Functional NMDA receptors are expressed by breast cancer and are important agents for maintaining cell growth and viability. PMID:19784770
  49. Polymorphisms in the GRIN1 and GRIN2B genes may serve as potential biomarkers for a reduced risk of PD among the Chinese population in Taiwan. PMID:20438806
  50. The neuronal coexistence of glutamate and NMDAR1, observed in painful tendinosis but not in controls, suggests a regulatory role in intensified pain signalling. PMID:19422642

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell junction, synapse, postsynaptic cell membrane. Cell junction, synapse, postsynaptic density.
Protein Families
Glutamate-gated ion channel (TC 1.A.10.1) family, NR1/GRIN1 subfamily
Database Links

HGNC: 4584

UNIGENE: Hs.558334

KEGG: hsa:2902

STRING: 9606.ENSP00000360608

OMIM: 138249

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products