Abbreviation
Recombinant Human FOLH1 protein, partial (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA.Immobilized Human FOLH1 at 2 μg/mL can bind Anti-FOLH1 recombinant antibody(CSB-RA008782MA1HU). The EC50 is 11.74-15.02 ng/mL.
②Measured by its binding ability in a functional ELISA.Immobilized Human FOLH1 at 2 μg/mL can bind Anti-FOLH1 recombinant antibody(CSB-RA008782MA2HU). The EC50 is 3.853-4.303 ng/mL.
Alternative Names
Glutamate carboxypeptidase 2; EC:3.4.17.21; Cell growth-inhibiting gene 27 protein; Folate hydrolase 1; Folylpoly-gamma-glutamate carboxypeptidase (FGCP); Glutamate carboxypeptidase II (GCPII); Membrane glutamate carboxypeptidase (mGCP); FOLH1; FOLH, NAALAD1, PSM, PSMA; GIG27
Species
Homo sapiens (Human)
Expression Region
44-750aa
Target Protein Sequence
KSSNEATNITPKHNMKAFLDELKAENIKKFLYNFTQIPHLAGTEQNFQLAKQIQSQWKEFGLDSVELAHYDVLLSYPNKTHPNYISIINEDGNEIFNTSLFEPPPPGYENVSDIVPPFSAFSPQGMPEGDLVYVNYARTEDFFKLERDMKINCSGKIVIARYGKVFRGNKVKNAQLAGAKGVILYSDPADYFAPGVKSYPDGWNLPGGGVQRGNILNLNGAGDPLTPGYPANEYAYRRGIAEAVGLPSIPVHPIGYYDAQKLLEKMGGSAPPDSSWRGSLKVPYNVGPGFTGNFSTQKVKMHIHSTNEVTRIYNVIGTLRGAVEPDRYVILGGHRDSWVFGGIDPQSGAAVVHEIVRSFGTLKKEGWRPRRTILFASWDAEEFGLLGSTEWAEENSRLLQERGVAYINADSSIEGNYTLRVDCTPLMYSLVHNLTKELKSPDEGFEGKSLYESWTKKSPSPEFSGMPRISKLGSGNDFEVFFQRLGIASGRARYTKNWETNKFSGYPLYHSVYETYELVEKFYDPMFKYHLTVAQVRGGMVFELANSIVLPFDCRDYAVVLRKYADKIYSISMKHPQEMKTYSVSFDSLFSAVKNFTEIASKFSERLQDFDKSNPIVLRMMNDQLMFLERAFIDPLGLPDRPFYRHVIYAPSSHNKYAGESFPGIYDALFDIESKVDPSKAWGEVKRQIYVAAFTVQAAAETLSEVA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
N-terminal 10xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
-
Activity
Measured by its binding ability in a functional ELISA.Immobilized Human FOLH1 at 2 μg/ml can bind Anti-FOLH1 recombinant antibody(CSB-RA008782MA1HU). The EC50 is 11.74-15.02 ng/mL.
-
Activity
Measured by its binding ability in a functional ELISA.Immobilized Human FOLH1 at 2 μg/mL can bind Anti-FOLH1 recombinant antibody(CSB-RA008782MA2HU). The EC50 is 3.853-4.303 ng/mL.
Description
Glutamate carboxypeptidase 2 (FOLH1/PSMA) cleaves the terminal glutamate from folylpolyglutamates and serves as a validated target in prostate cancer and neurological disorders, making quantitative binding studies critical for therapeutic antibody development. This mammalian-expressed protein spanning residues 44–750 demonstrates robust antibody recognition in functional ELISA, with EC50 values of 11.74–15.02 ng/mL and 3.853–4.303 ng/mL for two distinct anti-FOLH1 antibodies, providing quantitative benchmarks for epitope mapping studies and inhibitor screening assays where competitive binding must be measured. The N-terminal 10xHis tag facilitates purification while preserving the catalytic domain architecture required for IC50 determination and inhibition mechanism studies. With purity exceeding 90% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this preparation meets the quality thresholds commonly required for kinetic parameter analysis and serves as a positive control in enzyme-linked assays evaluating drug candidates targeting the FOLH1 active site.