Recombinant Human Gamma-glutamyl hydrolase (GGH), partial

Code: CSB-EP009389HU1
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$306
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
GGH
Uniprot NO.
Research Area
Metabolism
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
219-293aa
Target Protein Sequence
TNTDGKIEFISTMEGYKYPVYGVQWHPEKAPYEWKNLDGISHAPNAVKTAFYLAEFFVNEARKNNHHFKSESEEE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
43.9 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Hydrolyzes the polyglutamate sidechains of pteroylpolyglutamates. Progressively removes gamma-glutamyl residues from pteroylpoly-gamma-glutamate to yield pteroyl-alpha-glutamate (folic acid) and free glutamate. May play an important role in the bioavailability of dietary pteroylpolyglutamates and in the metabolism of pteroylpolyglutamates and antifolates.
Gene References into Functions
  1. Either methylation of CpG1 or hypermethylation of CpG2 in GGH promoter region can significantly reduce GGH mRNA expression in pediatric patients with acute leukemia. PMID:28278270
  2. the results of our study identify GGH as an ERG subtype specific molecular marker with modest prognostic relevance, which may have clinical relevance if analyzed in combination with other molecular markers. PMID:28146062
  3. the highest expression of GGH and EGFR was noted in the left-sided colon; the highest expression of DHFR, FPGS, TOP1 and ERCC1 was noted in the rectosigmoid, whereas TYMP expression was approximately equivalent in the right-sided colon and rectum PMID:26676887
  4. This study shows that polymorphisms on genes related to the metabolic pathway of pemetrexed, especially, ATIC and GGH genes, would have a therapeutic implication in pemetrexed-treated patients with lung adenocarcinoma PMID:25823786
  5. Polymorphism of GGH rs3758149 C>T is associated with response to therapy in acute lymphoblastic leukemia. PMID:24908438
  6. An interaction term, between FPGS rs7033913 heterozygotes and GGH rs11988534 homozygotes for the minor allele, had a p-value <0.0001 and may contribute to metotrexate toxicity in rheumatoid arthritis. PMID:24447348
  7. GG genotype of GGH -354 T > G polymorphism may have high predictive value for myelosuppression in methotrexate treated rheumatoid arthritis patients. PMID:22763757
  8. Suggest that GGH may serve as a potential biomarker of unfavorable clinical outcomes over short-term follow-up in breast cancer. PMID:23374458
  9. Genotyping of DHFR 829C>T and GGH -401C>T was performed using a polymerase chain reaction. PMID:22994778
  10. The results of our study suggested the potential interest of GGH -401C>T as a predictive factor of the outcome of cervical carcinoma treated with cisplatin-based chemoradiotherapy. PMID:23107767
  11. There was no significant difference in gamma-glutamyl hydrolase genotype or T allele frequency between the two groups (P> 0.05). PMID:22678806
  12. Genetic polymorphism of gamma-glutamyl hydrolase in Chinese acute leukemia children and identification of a novel double nonsynonymous mutation. PMID:22568793
  13. a SNP in the GGH gene remained associated with reduced CVD risk, with a stronger association in early onset CVD cases. PMID:22649255
  14. This is one of the first studies to assess FPGS and GGH genetic variants in relation to plasma homocysteine. PMID:22018726
  15. Genotypes in GGH gene of acute lymphoblastic leukemia patients were evaluated PMID:21538980
  16. The -401C/T polymorphism in the gamma-glutamyl hydrolase may be a factor involved in the generation of relapse to disease in patients with acute lymphoblastic leukemia. PMID:20197200
  17. Data revealed that high FPGS gene expression, low GGH gene expression and low ABCC1 gene expression in CRC tissues were predictive factors for a high reduced folate level after LV administration. PMID:19636555
  18. data implicate GGH as a novel biomarker for bladder cancer; suggest presence of GGH & diazepam-binding inhibitor in urine serves as a rationale for developing them as urinary markers of clinical outcomes for patients treated with neoadjuvant chemotherapy PMID:19815704
  19. Three-dimensional structure PMID:11953431
  20. cDNA microarray analysis led to the identification of 2 novel biomarkers that should facilitate molecular diagnosis and further study of pulmonary neuroendocrine tumors. PMID:15492986
  21. lack of dissociation of the dimer, large monomer-monomer interface, & presence of catalytically essential Tyr-36 in the homodimer interface sequences suggest that homodimer formation is required for hGH monomer to fold into an active conformation. PMID:16945597
  22. The genotype distribution and gene frequency of the GGH gene polymorphism was studied in a Japanese population. PMID:17409534
  23. CpG island methylator phenotype (CIMP+) in ColoRectal Cancer (CRC) is associated with low expression of GGH, suggesting involvement of the folate pathway in the development of this phenotype. PMID:18414409

Show More

Hide All

Subcellular Location
Secreted, extracellular space. Lysosome. Melanosome.
Protein Families
Peptidase C26 family
Database Links

HGNC: 4248

UNIGENE: Hs.78619

KEGG: hsa:8836

STRING: 9606.ENSP00000260118

OMIM: 601509

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products