Recombinant Human GTPase KRas (KRAS), partial

In Stock
Code: CSB-EP012493HU1
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$224
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: N-terminal 6xHis-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
KRAS
Uniprot NO.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
c Ki ras2; c Kirsten ras protein; c-K-ras; c-Ki-ras; Cellular c Ki ras2 proto oncogene; Cellular transforming proto oncogene; CFC2; cK Ras; GTPase KRas; K RAS p21 protein; K RAS2A; K RAS2B; K RAS4A; K RAS4B; K-Ras 2; KI RAS; Ki-Ras; KIRSTEN MURINE SARCOMA VIRUS 2; Kirsten rat sarcoma 2 viral (v Ki ras2) oncogene homolog; Kirsten rat sarcoma viral oncogene homolog; KRAS; KRAS proto oncogene, GTPase; KRAS1; KRAS2; N-terminally processed; NS; NS3; Oncogene KRAS2; p21ras; PR310 c K ras oncogene; PR310 cK ras oncogene; RALD; RASK_HUMAN; RASK2; Transforming protein p21; v Ki ras2 Kirsten rat sarcoma 2 viral oncogene homolog; v Ki ras2 Kirsten rat sarcoma viral oncogene homolog
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-168aa
Target Protein Sequence
TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
23.1kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description

The Human KRAS recombinant protein is conventionally generated by transfecting the recombinant DNA into a host cell, and then the host cells are cultured and the transfected DNA transcribed and translated. Different host cells can be chosen for recombinant protein production, the choice of which depends on the type of protein that needs to be generated, its functional activity and requisite yield. We choose E.coli as the expression system for this KRAS protein expression because bacteria cells are easy to culture, grow fast and produce high yields of recombinant protein.

KRAS is a protein coding gene that encodes GTPase KRas. According to some research, KRAS may have the following features.
KRAS mutation status predicts colorectal cancer response to cetuximab therapy. KRAS proteins play an important role in human cancers but have not yet succumbed to therapeutic attack. By determining the mutational status of EGFR and KRAS, treatment decisions regarding the use of these kinase inhibitors may be improved. GTPase KRAS inhibits the p53 tumor suppressor by activating the NRF2-regulated antioxidant defense system in cancer cells. The quantitative biophysical analysis identified key components that regulate the recruitment of the GTPase KRAS to the plasma membrane.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. Plays an important role in the regulation of cell proliferation. Plays a role in promoting oncogenic events by inducing transcriptional silencing of tumor suppressor genes (TSGs) in colorectal cancer (CRC) cells in a ZNF304-dependent manner.
Gene References into Functions
  1. Pesticide exposure may play a great role in malignant transformation of urinary bladder cells through mutation in the K-ras gene. PMID:29644616
  2. deletion of the oncogenic KRAS allele resulted in enhanced STIM1 expression and greater Ca(2+) influx. PMID:29748135
  3. PIP5K1A loss reduces oncogenic KRAS signaling. PMID:30194290
  4. GATAD2B interacts with C-MYC to enhance KRAS driven tumor growth. PMID:30013058
  5. the present study demonstrates that miR-422a may serve as a tumor suppressor in osteosarcoma via inhibiting BCL2L2 and KRAS translation both in vitro and in vivo Therefore, miR-422a could be developed as a novel therapeutic target in osteosarcoma. PMID:29358307
  6. our studies demonstrate how KRAS inhibits the tumor suppressor RKIP, thus offering novel justification for targeting RKIP as a strategy to overcome KRAS-induced tumor metastasis and chemoresistance in PDAC. PMID:29315556
  7. This study confirms the tumor suppressor roles of miR-193a-3p, its downstream target affinity to KRAS and clinical significance in patients with colorectal adenocarcinoma. PMID:29104111
  8. in Stage I colorectal cancer presence of KRAS mutations, that of simultaneous mutations in PIK3CA gene, or that of multiple KRAS mutations was significantly associated with shorter cancer specific survival; PIK3CA or multiple KRAS mutations were associated with nodal micrometastases and poorly differentiated clusters G3 as well PMID:30018674
  9. Inhibition of Wee1 by its specific inhibitor MK1775 in combination with sorafenib restored the KRAS mutated cells' response to the multi-target tyrosine kinase inhibitor. PMID:29343688
  10. High FOS-like antigen 1 (FOSL1) expression with mutant KRAS protein lung and pancreatic cancer patients showed the worst survival outcome. PMID:28220783
  11. primary resistance to cetuximab is dependent upon both KRAS mutational status and protein expression level, and acquired resistance is often associated with KRAS(Q61) mutations that function even when protein expression is low. PMID:28593995
  12. The HSF1-BAG3-Mcl-1 signal axis is critical for protection of mutant KRAS colon cancer cells from AUY922-induced apoptosis. PMID:29068469
  13. Study results indicate that pleural homed cancer cells harboring activating KRAS mutations are competent of malignant pleural effusion induction. This genotype-phenotype link is primarily mediated via mutant KRAS-dependent CCL2 signaling that results in the recruitment of CD11b+Gr1+ myeloid cells to the pleural space. PMID:28508873
  14. Copy number gains were seen in EGFR (two of 23, 13.0%) and in one (4.3%) of each PIK3CA, KRAS, MET and STK11 PMID:29489023
  15. Study reveals the novel function of NOX4 in reprogramming aerobic glycolysis initiated by activated Kras and inactivated p16 in pancreatic ductal adenocarcinoma. PMID:28232723
  16. The role of KRAS oncogenic signaling in cancer cells.[review] PMID:29263151
  17. High KRAS expression is associated with Bladder Cancer. PMID:29321082
  18. Studies on the metabolic properties of mutant KRAS protein lung tumors have uncovered unique metabolic features that can potentially be exploited therapeutically [Review]. PMID:28570035
  19. Plasma membrane polyphosphoinositides depletion caused rapid translocation of K-Ras4B but not H-Ras from the plasma membrane to the Golgi. PMID:28939768
  20. we used hot-spot mutation sequencing to examine whether KRAS/NRAS mutations, a characteristic feature of mesonephric carcinoma,1 are also present in mesonephric hyperplasia. None of the mesonephric hyperplasia cases harboured a KRAS or NRAS mutation. PMID:28703285
  21. KRAS mutations are associated with colorectal liver metastases. PMID:29937183
  22. Our data provide evidence that blocking TfR could significantly inhibit lung adenocarcinoma (LAC) proliferation by targeting the oncogene KRAS; therefore, TfR may be a therapeutic target for LAC. In addition, our results suggest a new method for blocking the signal from the oncogene KRAS by targeting TfR in LAC. PMID:29286585
  23. Results show mutation in Kras was associated with worse survival results in patients with pancreatic neoplasm. [review] PMID:30227250
  24. CFTR exhibited an inhibitory role in the malignancy of lung adenocarcinoma A549 cells PMID:29526175
  25. characteristics of the expression of epidermal growth factor receptor (EGFR), anaplastic lymphoma kinase (ALK), V-Ki-ras2 Kirsten rat sarcoma viral oncogene homologue (KRAS) in non-small cell lung cancer PMID:30037374
  26. Despite the presence of histological findings indicating long-standing gastroesophageal reflux in 25%, as well as symptomatic gastroesophageal reflux in more than 40%, there was no detectable tissue expression of KRAS or BRAF mutations in adult patients treated for esophageal atresia in childhood. PMID:28873491
  27. The high frequency of KRAS mutation in endometrial atypical hyperplasia with mucinous differentiation, endometrioid carcinoma with mucinous differentiation and mucinous carcinoma indicates that KRAS mutational activation is implicated in the pathogenesis of endometrial mucinous carcinoma. PMID:30220122
  28. The frequency of KRAS mutations was significantly higher in Serrated Lesions subgroups with low and intermediate methylated epigenotype tumors and microsatellite stability. PMID:29974407
  29. The rate of EGFR mutation was significantly higher in female and non-smoker patients. In TTF-1 positive cases EGFR mutation was more frequent. Age of the patients over 62-year old was correlated with KRAS mutations. The concordance between ALK IHC and FISH was 58.3%. The MET protein in the cases with MET amplification was 100% positive. PMID:28756651
  30. the findings demonstrated that mutated K-ras promotes cathepsin L expression and plays a pivotal role in EMT of human lung cancer. The regulatory effect of IR-induced cathepsin L on lung cancer invasion and migration was partially attributed to the Cathepsin L /CUX1-mediated EMT signaling pathway PMID:29246726
  31. These findings collectively suggest that the triple combination of survivin knockdown with ABT-263 and trametinib treatment, may be a potential strategy for the treatment of KRAS-mutant lung adenocarcinoma. Furthermore, our findings indicate that the welldifferentiated type of KRAS-mutant lung tumors depends, at least in part, on TTF1 for growth. PMID:29658609
  32. Increased long noncoding RNA HomeoboxA transcript at the distal tip (HOTTIP) expression was associated with poor prognosis independent of KRAS mutation. PMID:29329159
  33. Data show no patient positive for KRAS mutation and/or p53 mutation was found to have malignant transformation, suggesting detection of KRAS or p53 mutation in plasma is not an effective screening tool for pancreatic cancer because accumulation of multiple mutations is required for malignant transformation in the pancreas. PMID:29303908
  34. BCL-XL has a role in modulating RAS signalling to favor breast cancer cell stemness PMID:29066722
  35. KRAS is one of the most common mutations in Non-small cell lung cancer. [review] PMID:29764594
  36. Combination of PCR HRM with either RFLP or direct DNA sequencing was useful to detect K-RAS exon 2 and extended RAS mutations, respectively. Frequency of all RAS mutations in stage IV Indonesian (41%) was similar among Asians (41-49%), which tend to be lower than western (55%) CRC. PMID:28044264
  37. PPARgamma activator, pioglitazone, can activate p21, which is associated with decreased proliferation in 2 aerodigestive preneoplastic cell lines. In addition, the p21 gene may be a potential hypothesis-driven biomarker in translational studies of pioglitazone as a chemoprevention agent for aerodigestive cancer. PMID:30047791
  38. show that mutant KRAS facilitates IKKalpha-mediated responsiveness of tumor cells to host IL-1beta, thereby establishing a host-to-tumor signaling circuit that culminates in inflammatory MPE development and drug resistance PMID:29445180
  39. In a cohort of patients with pancreatic cysts, KRAS and GNAS mutations had no significant diagnostic benefit in comparison with conventional testing. PMID:29796909
  40. Results reveal that KRAS 3'UTR is a target for miR-19a which overexpression suppresses KRAS expression thus inhibiting angiogenesis in colorectal cancer. PMID:29207158
  41. observed that the trend is highly correlative of the rate of change in KRAS mutant DNA concentrations and the period of monitoring PMID:28956302
  42. Mutation frequencies in KRAS exon 3 or 4, NRAS, BRAF, and PIK3CA were 5.5%, 2.7%, 8.3%, and 5.5%, respectively. PMID:29908105
  43. Fluorescence cross-correlation data indicate no direct interaction between C6-ceramide and KRas4B, suggesting that KRas4B essentially recruits other lipids. A FRET-based binding assay reveals that the stability of KRas4B proteins inserted into the membrane containing C6-ceramide is reduced. PMID:29357287
  44. Identification of KRAS/NRAS/BRAF mutation status is crucial to predict the therapeutic effect and determine individual therapeutic strategies for patients with colorectal cancer. PMID:29335867
  45. KRAS mutation was significantly associated with tumor size PMID:29103773
  46. Our finding of frequent KRAS mutation in urachal adenocarcinoma suggests its potential role in the oncogenesis of this neoplasm PMID:28285720
  47. a low frequency of BRAF or KRAS mutation in Chinese patients with low-grade serous carcinoma of the ovary PMID:29273082
  48. The authors report that one of the K-Ras splice variants, K-Ras4a, is subject to lysine fatty acylation, a previously under-studied protein post-translational modification. Sirtuin 2 (SIRT2), one of the mammalian nicotinamide adenine dinucleotide (NAD)-dependent lysine deacylases, catalyzes the removal of fatty acylation from K-Ras4a. PMID:29239724
  49. Data indicate that absence of KRAS, TP53 and SMAD4 genetic alterations may identify a subset of pancreatic carcinomas with better outcome. PMID:29103024
  50. Proteoforms with or without the Gly13Asp mutation (G13D) in the KRAS4b isoform were studied in isogenic KRAS colorectal cancer (CRC) cell lines and patient CRC tumors with matching KRAS genotypes. In 2 cellular models, a direct link between knockout of the mutant G13D allele and complete nitrosylation of cysteine 118 of the remaining WT KRAS4b was observed. Major differences in C-terminal carboxymethylation were seen. PMID:29610327

Show More

Hide All

Subcellular Location
Cell membrane; Lipid-anchor; Cytoplasmic side. Cytoplasm, cytosol.; [Isoform 2B]: Cell membrane; Lipid-anchor.
Protein Families
Small GTPase superfamily, Ras family
Database Links

HGNC: 6407

UNIGENE: Hs.37003

KEGG: hsa:3845

STRING: 9606.ENSP00000256078

OMIM: 190070

  Email: support@cusabio.com
  Distributors Worldwide

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products