Recombinant Human G1/S-specific cyclin-D3 (CCND3), Biotinylated

Code: CSB-EP004814HU-B
Size:
20ug
20ug100ug1mg
US$368
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Abbreviation
Recombinant Human CCND3 protein, Biotinylated
Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
CCND3
Uniprot NO.
Research Area
Cell Biology
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-292aa
Target Protein Sequence
MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
80.3 kDa
Protein Length
Full Length
Tag Info
N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Regulatory component of the cyclin D3-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G(1)/S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complex and the subsequent transcription of E2F target genes which are responsible for the progression through the G(1) phase. Hypophosphorylates RB1 in early G(1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Component of the ternary complex, cyclin D3/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex. Shows transcriptional coactivator activity with ATF5 independently of CDK4.
Gene References into Functions
  1. The Novel Short Isoform of Securin Stimulates the Expression of Cyclin D3 and Angiogenesis Factors VEGFA and FGF2, but Does Not Affect the Expression of MYC Transcription Factor PMID:29989583
  2. miR-212 exerts growth-suppressive effects in Adult T-cell leukemia/lymphoma (ATL) cells largely by targeting CCND3 and may have therapeutic potential in ATL. PMID:27493231
  3. Cyclin D3 is expressed in the majority of splenic diffuse red pulp small B-cell lymphomas. Increased expression is sometimes the result of somatic mutations in the PEST domain of the CCND3 gene. PMID:28069605
  4. in ovarian cancer cells, DOT1L regulates the transcription of G1 phase genes CDK6 and CCND3 through H3K79 dimethylation PMID:28114995
  5. metabolic function of cyclin D3-CDK6 kinase in cancer cell survival PMID:28607489
  6. we showed that ZNF224 positively modulates cyclin D3 gene expression. Consistently, we observed that alteration of ZNF224 expression leads to defects in cell cycle control. All together, our results strongly suggest that in Chronic lymphocytic leukaemia (CLL)cells high expression level of ZNF224 can lead to inappropriate cell growth and apoptosis resistance, thus contributing to CLL progression PMID:28040726
  7. the activation of TLR7 increased CCND3 expression via the downregulation of miR-15b in B cells. PMID:26144250
  8. This study describes the identification and characterization of cyclin D3 as a novel interactor of influenza A virus M2 protein. PMID:28130444
  9. MicroRNA-138 interacts with cyclin D3 and negatively regulates non-small cell lung cancer cells PMID:26201895
  10. Combined urinary FGFR3/Cyclin D3 expression shows improved detection rates for bladder cancer recurrence with high specificity and sensitivity. PMID:26861974
  11. The CDK6-cyclin D3 pair play a fundamental role in controlling CDK2-dependent SAMHD1 phosphorylation and the dNTP pool in primary macrophages. PMID:25927932
  12. Two recurrent fusion genes associated with the 12q locus, LRP1-SNRNP25 and KCNMB4-CCND3, were by RT-PCR, Sanger sequencing and FISH, and were found to be osteosarcoma specific in a validation cohort of 240 other sarcomas. PMID:25300797
  13. G1 arrest induced by SB265610 occurred at concentrations lacking CXCR2 selectivity and revealed cyclin-dependent kinase 2 (CDK2) (Thr160) hypophosphorylation, cyclin D3 gene down-regulation, and p21 post-translational induction PMID:26026083
  14. sLZIP regulates the transcription of cyclin D3 by binding directly to the AP-1 region in the cyclin D3 promoter. PMID:24441043
  15. combined expression of miR-138 and its direct target CCND3 may be correlated with significant characteristics of hepatocellular carcinoma PMID:25439221
  16. Namely the amplification of the expression of the PLCB1a, but not of PLCB1b, is able to maintain high levels of expression of cyclin D3 even after treatment with kinamycin F PMID:25160985
  17. cell cycle related proteins PCNA, Ki67, cyclin D3, p27 and p57 were expressed in both normal and diabetic human term placentas. PMID:23963898
  18. two cell cycle-related molecules, cyclin D3 and E2F3, were identified as the direct miR-503 targets. PMID:23967867
  19. PCNSL prognosis is relatively poor. Age, high tumor burden, higher lymphocyte count, expression of Cyclin D3, and Cyclin E are inferior prognostic factors for PCNSL. PMID:23422111
  20. CCND3 gene amplification is a marker of aggressiveness and might be a predictor of tumor progression in bladder urothelial carcinoma PMID:23830405
  21. Study reports that a cis-acting element, located between nucleotides 31 and 50 of the human CCND3 5' UTR, forms a stable G-quadruplex structure and represses translation of a reporter gene and the CCND3 gene in human cell lines. PMID:22858673
  22. Lycorine hydrochloride effectively inhibited mitotic proliferation of Hey1B cells through enhanced expression of the cell cycle inhibitor p21 and marked down-regulation of cyclin D3 expression. PMID:23376478
  23. No significant correlation was found between p-27, Cyclin D3, and cyclin E in pediatric Embryonal tumors PMID:22763761
  24. 7 gains of CCND3 were seen amon 17 orbital adnexa MALT lymphomas. CCND3 might simply be a marker of 6p gains and not play a major role in the pathogenesis of MALT lymphomas. PMID:23240690
  25. cyclin D3 is reduced in myotonic dystrophy due to increased phosphorylation at T283 by GSK3beta, which triggers the degradation of cyclin D3. PMID:23160194
  26. CCND3 protein expression was observed to be negatively correlated with miR-138 expression in HCC tissues. PMID:22362728
  27. The overexpression of ETS1 could suppress cyclin D3 mRNA and protein levels. PMID:21841808
  28. Lymph node sections from 138 HL patients were immunohistochemically stained for cyclin D3 (CCND3), MCM2 and MCM7 aiming to investigate clinical outcome. PMID:21965782
  29. These results suggest that alpha9-nAChR-mediated cyclin D3 overexpression is important for nicotine-induced transformation of normal human breast epithelial cells. PMID:20229177
  30. In addition to having a pivotal role in the up-regulation of IL-2 and IL-2RA gene expression, IKK controls the expression of cyclin D3, cyclin E and CDK2, and the stability SKP2 and its co-factor CKS1B, through mechanisms independent of IL-2. PMID:20465575
  31. Overexpressions of nuclear cyclin D3 is associated with non-small cell lung cancer. PMID:20631637
  32. study suggests that Cyclin D3 gene amplification might be a predictor of aggressiveness in BCG-treated bladder urothelial carcinoma in situ PMID:20821231
  33. Gene knockdown of cyclin D3 did not inhibit pRb phosphorylation on cdk4/6- and cdk2-specific residues or measurably affect viability and proliferation. PMID:20107311
  34. Ubiquitin/proteasome-dependent degradation of D-type cyclins is linked to tumor necrosis factor-induced cell cycle arrest. PMID:11864973
  35. High cyclin D3 expression had a significantly lower response to antineoplastic agents in diffuse large B-cell lymphomas PMID:11895902
  36. interaction with p58(PITSLRE) PMID:12082095
  37. A cofactor of retinoic acid receptors, modulating their activity in the presence of cellular retinoic acid-binding protein II. PMID:12482873
  38. cyclin D3 is activated by E2F1;the essential E2F regulatory element of the cyclin D3 promoter is between nucleotides -143 and -135 relative to the initiating methionine codon PMID:12611887
  39. overexpression of cyclin D3 was mutually exclusive with Rb/p16 aberrant expression status supporting an oncogenic role for cyclin D3 PMID:12647795
  40. High levels of this protein are gound in malignant glioma. PMID:12778072
  41. cyclin D3 protein is expressed in a fraction of human goiters but it is strongly overexpressed in most follicular adenomas PMID:14576819
  42. cyclin d3 does not have a role in regulating AML1/RUNX1 increase during G1 to S cell cycle progression PMID:14747476
  43. GSK-3beta has a role in cAMP-induced degradation of cyclin D3 PMID:15252116
  44. Increased expression of Cyclin D3 is associated with follicular lymphoma PMID:15305377
  45. cyclin D3 is degraded via proteasome and that Thr-283 is essential for its degradation PMID:15326477
  46. cyclin D3 specifically interacted with eIF3k through its C-terminal domain; eIF3k distributed both in nucleus and cytoplasm and colocalized with cyclin D3 PMID:15327989
  47. activating transcription factor 5 (ATF5) is a new interacting partner of cyclin D3 PMID:15358120
  48. silencing cyclin D3 by RNA interference inhibits S phase entry and sensitizes breast cancer cells to TRAIL, indicating a key role for cyclin D3 repression in these events PMID:15569667
  49. cyclin D3 may have a role in progression of laryngeal squamous cell carcinoma PMID:15671552
  50. Cyclin D3 up-regulated transcriptional activity of VDR and this effect was counteracted by overexpression of CDK4 and CDK6 PMID:16105657

Show More

Hide All

Subcellular Location
Nucleus. Cytoplasm.
Protein Families
Cyclin family, Cyclin D subfamily
Database Links

HGNC: 1585

UNIGENE: Hs.534307

KEGG: hsa:896

STRING: 9606.ENSP00000362082

OMIM: 123834

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products