Recombinant Human Frizzled-3 (FZD3), partial

Code
MSDS	MSDS
Size	Pls inquire
Source
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

>85% (SDS-PAGE)

Target Names

FZD3

Uniprot NO.

Q9NPG1

Species

Homo sapiens (Human)

Source

Yeast

Protein Length

Partial

Tag Info

N-terminal His-tagged/Tag-Free

Storage

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Description

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

■ Q&A

I have another request. I need have information about this product CSB-MP882067HU1?
I need just extracellular fragment of this receptor, can you please tell me that they are extracellular fragment of FZD3 receptor or not?

Thanks for your inquiry. We can provide partial protein (extracellular fragment) of FZD3 receptor, pls check information as follows:
Partial protein (The first complete extracellular domain at the N-terminus)
Recombinant Human Frizzled-3(FZD3),partial
CSB-YP882067HU1 >> Yeast
CSB-EP882067HU1 >> E.coli
CSB-BP882067HU1 >> Baculovirus
CSB-MP882067HU1 >> Mammalian cell
Expression Region:23-205aa; Partial, the first complete extracellular domain at the N-terminal
Tag information:YP: N-terminal 6xHis-tagged; EP, BP, MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Sequence:

HSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAALAMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVPWPEDMECSRFPDCDEPYPRLVDLNLAGEPTEGAPVAVQRDYGFWCPRELKIDPDLGYSFLHVRDCSPPCPNMYFRREELSFARYF

Target Background

Function

Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. Activation by Wnt5A stimulates PKC activity via a G-protein-dependent mechanism. Involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Plays a role in controlling early axon growth and guidance processes necessary for the formation of a subset of central and peripheral major fiber tracts. Required for the development of major fiber tracts in the central nervous system, including: the anterior commissure, the corpus callosum, the thalamocortical, corticothalamic and nigrostriatal tracts, the corticospinal tract, the fasciculus retroflexus, the mammillothalamic tract, the medial lemniscus, and ascending fiber tracts from the spinal cord to the brain. In the peripheral nervous system, controls axon growth in distinct populations of cranial and spinal motor neurons, including the facial branchimotor nerve, the hypoglossal nerve, the phrenic nerve, and motor nerves innervating dorsal limbs. Involved in the migration of cranial neural crest cells. May also be implicated in the transmission of sensory information from the trunk and limbs to the brain. Controls commissural sensory axons guidance after midline crossing along the anterior-posterior axis in the developing spinal cord in a Wnt-dependent signaling pathway. Together with FZD6, is involved in the neural tube closure and plays a role in the regulation of the establishment of planar cell polarity (PCP), particularly in the orientation of asymmetric bundles of stereocilia on the apical faces of a subset of auditory and vestibular sensory cells located in the inner ear. Promotes neurogenesis by maintaining sympathetic neuroblasts within the cell cycle in a beta-catenin-dependent manner.

Gene References into Functions

This study identified Circular RNA circ-CBFB as a sponge of miR-607, which targeted FZD3. PMID:29902450
schizophrenia may be related to some polymorphisms of gene FZD3 that are in stronger linkage disequilibrium to Chinese than to the other populations studied (Meta-Analysis) PMID:27755292
marked reduction in the prominence of TUJ1 bundles in number, thickness, and length. Our results showed that deregulation of the planar cell polarity genes CELSR3 and FZD3 might disrupt the enteric innervation pattern PMID:27619161
seven-transmembrane domain receptors Celsr3 and Fzd3, in particular, control the development of most longitudinal tracts in the central nervous system. [Review] PMID:25813877
Our analysis showed no significant association between the rs2241802 polymorphism in FZD3 gene and neural tube defects PMID:24816679
DNA methylation aberrations rather than polymorphisms of FZD3 gene increase the risk of spina bifida in a high-risk region for neural tube defects. PMID:25131656
Wnt3a/Frizzled-3 signaling plays important role in regulating the proliferation and differentiation of neural crest cells and various developmental stages of melanocyte precursors. PMID:24815018
Aberrant methylation modification of the FZD3 gene increases the risk of congenital hydrocephalus by altering chromatin structure and disturbing gene expression. PMID:24796881
FZD3 signaling sensitized peripheral sensory neurons in pain hypersensitivity. PMID:24991956
clinical significance of frizzled homolog 3 protein in colorectal cancer patients PMID:24255701
Genetic variants of the FZD3 gene may affect susceptibility to schizophrenia in Chinese Han and Va populations. PMID:22027177
This study found a significant association between schizophrenia and the FZD3 gene in single nucleotide polymorphisms and haplotype analyses. PMID:14642436
Results suggested that the FZD3 gene might be involved in the predisposition to schizophrenia. PMID:15274031
The FZD3 gene does not play a role in conferring susceptibility to schizophrenia variants in a Japanese sample. PMID:15657645
In German patients, neither single markers nor haplotypes in FZD3 were associated with schizophrenia. Further exploratory analyses using a different diagnostic approach did also not yield significant results. PMID:17982906
Fzd3 is expressed in Ewing sarcoma family tumor cell lines. Fzd3 mediated Wnt-3a-dependent neurite outgrowth. PMID:18212053

Hide All

Subcellular Location

Membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cell surface. Apical cell membrane; Multi-pass membrane protein.

Protein Families

G-protein coupled receptor Fz/Smo family

Tissue Specificity

Widely expressed. Relatively high expression in the CNS, including regions of the limbic system, in kidney, pancreas, skeletal muscle, uterus and testis.

Database Links

HGNC: 4041

UNIGENE: Hs.40735

KEGG: hsa:7976

STRING: 9606.ENSP00000240093

OMIM: 606143

Promotions