Recombinant Human Focal adhesion kinase 1 (PTK2), partial

Code
MSDS
Size Pls inquire
Source
Conjugate
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
PTK2
Uniprot NO.
Alternative Names
Focal adhesion kinase 1; FADK 1; EC 2.7.10.2; Focal adhesion kinase-related nonkinase; FRNK; Protein phosphatase 1 regulatory subunit 71; PPP1R71; Protein-tyrosine kinase 2; p125FAK; pp125FAK; PTK2 FAK FAK1
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
35-355
Target Protein Sequence
RVLKVFHYFESNSEPTTWASIIRHGDATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEWKYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSYWEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESILKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFTQVQTIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGTS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Non-receptor protein-tyrosine kinase that plays an essential role in regulating cell migration, adhesion, spreading, reorganization of the actin cytoskeleton, formation and disassembly of focal adhesions and cell protrusions, cell cycle progression, cell proliferation and apoptosis. Required for early embryonic development and placenta development. Required for embryonic angiogenesis, normal cardiomyocyte migration and proliferation, and normal heart development. Regulates axon growth and neuronal cell migration, axon branching and synapse formation; required for normal development of the nervous system. Plays a role in osteogenesis and differentiation of osteoblasts. Functions in integrin signal transduction, but also in signaling downstream of numerous growth factor receptors, G-protein coupled receptors (GPCR), EPHA2, netrin receptors and LDL receptors. Forms multisubunit signaling complexes with SRC and SRC family members upon activation; this leads to the phosphorylation of additional tyrosine residues, creating binding sites for scaffold proteins, effectors and substrates. Regulates numerous signaling pathways. Promotes activation of phosphatidylinositol 3-kinase and the AKT1 signaling cascade. Promotes activation of MAPK1/ERK2, MAPK3/ERK1 and the MAP kinase signaling cascade. Promotes localized and transient activation of guanine nucleotide exchange factors (GEFs) and GTPase-activating proteins (GAPs), and thereby modulates the activity of Rho family GTPases. Signaling via CAS family members mediates activation of RAC1. Recruits the ubiquitin ligase MDM2 to P53/TP53 in the nucleus, and thereby regulates P53/TP53 activity, P53/TP53 ubiquitination and proteasomal degradation. Phosphorylates SRC; this increases SRC kinase activity. Phosphorylates ACTN1, ARHGEF7, GRB7, RET and WASL. Promotes phosphorylation of PXN and STAT1; most likely PXN and STAT1 are phosphorylated by a SRC family kinase that is recruited to autophosphorylated PTK2/FAK1, rather than by PTK2/FAK1 itself. Promotes phosphorylation of BCAR1; GIT2 and SHC1; this requires both SRC and PTK2/FAK1. Promotes phosphorylation of BMX and PIK3R1. Isoform 6 (FRNK) does not contain a kinase domain and inhibits PTK2/FAK1 phosphorylation and signaling. Its enhanced expression can attenuate the nuclear accumulation of LPXN and limit its ability to enhance serum response factor (SRF)-dependent gene transcription.; Isoform 6 (FRNK) does not contain a kinase domain and inhibits PTK2/FAK1 phosphorylation and signaling. Its enhanced expression can attenuate the nuclear accumulation of LPXN and limit its ability to enhance serum response factor (SRF)-dependent gene transcription.
Gene References into Functions
  1. LFA-1 cross-linking recruits and activates FAK1 and PYK2 to phosphorylate LAT selectively on a single Y-171 site that binds to the GRB2-SKAP1 complex and limits dwell times of T-cells with dendritic cells PMID:28699640
  2. Results identified FAK mRNA as a direct target of miR-433. Its activation inhibits the effect of microRNA433 on the growth of cervical cancer cells. PMID:30272334
  3. This study shows that Leu33Pro polymorphism of integrin beta 3 modulates platelet Src pY418 and focal adhesion kinase pY397 phosphorylation in response to abnormally high shear stress. Whereas physiological shear stress does not affect platelet signaling, abnormally high-shear stress considerably elevates Src and FAK phosphorylation in both Pro33 and Leu33 platelets. PMID:29965811
  4. High FAK expression is associated with gastric cancer. PMID:30106432
  5. These results indicate that PCTK3 controls actin cytoskeleton dynamics by negatively regulating the FAK/Rho signaling pathway. PMID:28361970
  6. FAK is required for adipocyte survival and maintenance of insulin sensitivity, particularly in the context of adipose tissue expansion as a result of caloric excess. PMID:28165007
  7. Data suggest that TYRO3-mediated phosphorylation of ACTN4 is involved in invasiveness of melanoma cells; TYRO3-mediated phosphorylation of ACTN4 requires FAK activation at tyrosine 397. (TYRO3 = TYRO3 protein tyrosine kinase; ACTN4 = actinin alpha 4; FAK = focal adhesion kinase isoform FAK1) PMID:29274473
  8. FAK controls invasiveness of tumor cells by regulating focal adhesion-mediated motility. PMID:29133485
  9. FAK controls the nuclear translocation and activation of YAP in response to mechanical activation and submit that the YAP-dependent process of durotaxis requires a cell with an asymmetric distribution of active and inactive FAK molecules. PMID:29070586
  10. Results show thatproto-Oncogene Protein ets-1 (ETS1) drives ovarian cancer (OC) metastasis phenotypes through its transcriptional target PTK2 (focal adhesion kinase FAK). PMID:29174800
  11. Methylmercury chloride negatively affects the activation of Src, Rac1 and Cdc42, all of which are critical proteins for the regulation of cell movement. PMID:29197552
  12. This study demonstrated that the Cas scaffolding protein family member 4 and protein tyrosine kinase 2 proteins and their significant role in the activation of downstream signaling pathways in Alzheimer's disease. PMID:29789968
  13. Calpain small subunit 1 (Capn4) overexpression increased the protein level of cleaved talin and and activated the focal adhesion kinase (FAK)/AKT/MAPK signaling in 786-O cells, while Capn4 silencing decreased the protein level of cleaved talin in Caki-1 cells. PMID:29648579
  14. mitochondria are present at the leading edge of migrating cells, SIRT3 expression is down-regulated during migration, resulting in elevated ROS levels. This SIRT3-mediated control of ROS represses Src oxidation and attenuates focal adhesion kinase (FAK) activation. PMID:29915029
  15. These results demonstrated that the inhibition of FAK promoted cell detachment by decreasing the expression of focal adhesions components (talin and paxillin), and inhibiting cell motility by reducing the levels of Rho GTPases (Rac1, Cdc42 and RhoA). PMID:29484384
  16. The results showed that in cervical cancer cells Rac1 activation by hypoxia could stimulate invasion and migration, and this process was mediated by integrin a5b3-facilitated FAK and PI3K phosphorylation. PMID:29358562
  17. MUC4/X facilitated pancreatic cancer (PC) tumorigenesis via integrin-beta1/FAK/ERK signaling pathway. Overall, these findings revealed the novel role of MUC4/X in promoting and sustaining the oncogenic features of PC. PMID:29777904
  18. The addition of LCS to capecitabine treatment led to an increase in the proteolysis of the FAK signaling cascade components. PMID:30061234
  19. MPAP suppressed cancer cell proliferation and the phosphorylation of FAK1. Combined treatment with MPAP and irradiation (IR) showed enhanced suppression of cancer cell proliferation in wild-type p53 cells and more intense suppression in p53-null cells PMID:29048635
  20. Optogenetic control of FAK signaling has been described. PMID:29074139
  21. results suggest that W2 suppresses cancer cell migration and invasion by inhibiting FAK/STAT3 signaling and STAT3 translocation to the nucleus in monomorphic malignant human glioma cells. PMID:28498494
  22. these results suggest that Ascochlorin inhibits cell migration and invasion by blocking FAK and JAK/STAT signaling, resulting in reduced MMP-2 activity. PMID:28569433
  23. High levels of phosphorylated tyrosine-397 FAK in the nucleus of patient-derived melanoma tissues. PMID:28348210
  24. The RNA-editing enzyme ADAR promotes lung adenocarcinoma migration and invasion by stabilizing FAK. PMID:28928239
  25. The ectopic overexpression of miR-379 inhibited cell migration, invasion and EMT progress, while downregulated miR-379 reversed the effect. In addition, miR-379 regulated the focal adhesion kinase (FAK) by directly binding to its 3'-UTR, resulting in suppression of AKT signaling. In clinical samples of gastric cancer (GC), miR-379 inversely correlated with FAK, which was upregulated in GC. PMID:28713929
  26. Building upon previous work suggesting that FAK-Akt1 binding is mediated by the FAK F1 lobe, we demonstrated that independently expressing the F1 domain in human Caco-2 or murine CT-26 colon cancer cells by transient or stable inducible plasmid expression respectively prevents the stimulation of cancer cell adhesion by increased extracellular pressure. PMID:28820394
  27. functional activation of FAK1 in metastases and provide preclinical rationale for targeting this kinase in the setting of advanced ccRCC PMID:28418903
  28. this study shows that simultaneous deactivation of FAK and Src improves the pathology of hypertrophic scar PMID:27181267
  29. Silencing of p130Cas and inhibition of FAK activity both strongly reduced imatinib and nilotinib stimulated invasion. PMID:27293031
  30. IP6K1 physiologically regulates neuronal migration by binding to alpha-actinin and influencing phosphorylation of both FAK and alpha-actinin through its product 5-diphosphoinositol pentakisphosphate. PMID:28154132
  31. These data indicate that Ang II-AT2R regulates human bone marrow MSC migration by signaling through the FAK and RhoA/Cdc42 pathways. PMID:28697804
  32. upregulated FAK expression correlates with poor prognosis and tumor dissemination in surgically treated patients with hypopharyngeal cancer PMID:27061113
  33. These findings suggest that the integrin beta4-FAK/Src signaling axis may play a crucial role in clonorchiasis-associated cholangiocarcinoma metastasis during tumor progression. PMID:28286026
  34. whereas Src activation under shear stress is dominantly ligand-dependent, FAK signaling seems to be mostly shear induced. PMID:27467982
  35. The miR-7 can inhibit the activation of ERK/MAPK signaling pathway by down-regulating FAK expression, thereby suppressing the proliferation, migration and invasion of NSCLC cells. The miR-7 and its target gene FAK may be novel targets for the diagnosis and treatment of NSCLC. PMID:27764812
  36. Thrombomodulin (TM) promotes angiogenesis by enhancing cell adhesion, migration, and FAK activation through interaction with fibronectin. PMID:27602495
  37. FAK activation may facilitate tumour initiation by causing resistance to apoptosis. PMID:27611942
  38. Among a group of tumor cells, there is correlation between activation of the MRTF-dependent transcription and activated FAK-dependent regulation of cell migration. PMID:27708220
  39. Our study suggests that FOXM1 transcription factor regulates Integrin b1 gene expression and that FOXM1/ Integrin-b1/FAK axis may play an important role in the progression of Triple-negative breast cancer PMID:28361350
  40. It has been demonstrated that FAK depletion reduces hepatocellular carcinoma cell growth by affecting cancer-promoting genes including the pro-oncogene EZH2. PMID:28338656
  41. High FAK expression is associated with breast cancer cell invasion, transendothelial migration and metastasis. PMID:26993780
  42. Study provides evidence that PTK2 expression is regulated by KCNMA1 in gastric tumorigenesis. PMID:28231797
  43. HER2 reduces the radiosensitivity of breast cancer by activating Fak in vitro and in vivo. PMID:27286256
  44. The interaction between FAK and tetraspan proteins in physiological and pathological conditions is reviewed. PMID:27279237
  45. BKCa has a role in promoting growth and metastasis of prostate cancer through facilitating the coupling between alphavbeta3 integrin and FAK PMID:27233075
  46. Proteomic analysis identified PTK2/FAK overexpression is a biomarker of radioresistance in locally advanced HNSCC, and PTK2/FAK inhibition radiosensitized HNSCC cells. PMID:27036135
  47. FAK-Src-Paxillin system is a marker of unfavorable prognosis for human Neuroblastoma patients but also a promising therapeutic target. PMID:29040002
  48. IGF-II siRNA inactivates the FAK/PI3K/Akt signaling pathway, and further reduces cell proliferation, N-ras and C-myc levels in SMMC-7721 cells. PMID:27768959
  49. The purpose of this study was to determine the maximum tolerated dose (MTD), safety, pharmacokinetics (PK), and pharmacodynamics (PD) of the FAK inhibitor, GSK2256098, in cancer patients.GSK2256098 has an acceptable safety profile, has evidence of target engagement at doses at or below the MTD, and has clinical activity in patients with mesothelioma, particularly those with merlin loss PMID:27733373
  50. Studies suggest that signaling pathways downstream of activated FAK including paxillin will be important to study in the context of FAK inhibition and other therapeutics to identify novel biomarkers. PMID:26980710

Show More

Hide All

Subcellular Location
Cell junction, focal adhesion. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Cytoplasm, cell cortex. Cytoplasm, cytoskeleton. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome. Nucleus. Cytoplasm, cytoskeleton, cilium basal body. Note=Constituent of focal adhesions. Detected at microtubules.
Protein Families
Protein kinase superfamily, Tyr protein kinase family, FAK subfamily
Tissue Specificity
Detected in B and T-lymphocytes. Isoform 1 and isoform 6 are detected in lung fibroblasts (at protein level). Ubiquitous. Expressed in epithelial cells (at protein level).
Database Links

HGNC: 9611

UNIGENE: Hs.395482

KEGG: hsa:5747

STRING: 9606.ENSP00000341189

OMIM: 600758

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1