Recombinant Human Fibronectin (FN1), partial

In Stock
Code: CSB-EP008759HU1
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$224
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: His-tag
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
FN1
Uniprot NO.
Research Area
Cancer
Alternative Names
Cold-insoluble globulin (CIG)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
732-911aa
Target Protein Sequence
TASSFVVSWVSASDTVSGFRVEYELSEEGDEPQYLDLPSTATSVNIPDLLPGRKYIVNVYQISEDGEQSLILSTSQTTAPDAPPDPTVDQVDDTSIVVRWSRPQAPITGYRIVYSPSVEGSSTELNLPETANSVTLSDLQPGVQYNITIYAVEENQESTPVVIQQETTGTPRSDTVPSPR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
23.6 kDa
Protein Length
Partial
Tag Info
His-tag
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description

The recombinant human Fibronectin (FN1) protein expression in E.coli cells requires the insertion of a DNA fragment encoding the human FN1 protein (732-911aa) into a plasmid vector along with an N-terminal His tag gene and the transferral of this vector into E.coli cells. The positive cells are screened, cultured, and induced to express the FN1 protein. The cells are lysed to harvest the recombinant human FN1 protein, which is purified through affinity purification and then detected by SDS-PAGE and subsequent staining of the gel with Coomassie Brilliant Blue. The purity of this recombinant human FN1 protein is over 90%.

FN1 is a large glycoprotein that plays a significant role in the extracellular matrix (ECM) assembly. It acts as a scaffold for depositing other ECM proteins, such as collagens [2]. Fibronectin facilitates interactions between cells and the ECM [1]. It binds to integrins via specific binding sites, notably the Arg-Gly-Asp (RGD) sequence, promoting the formation of insoluble fibrils within the ECM [3]. Integrins, such as αVβ1 and α5β1, interact with fibronectin and regulate key cellular processes including embryogenesis, wound healing, blood coagulation, host defense, and metastasis [4][5]. The matrix form of fibronectin is essential for cell adhesion and migration, particularly during embryogenesis, wound healing, and inflammatory responses [6].

References:
[1] V. Koteliansky, M. Glukhova, M. Benjamin, В. Смирнов, V. Filimonov, O. Zaliteet al., A study of the structure of fibronectin, European Journal of Biochemistry, vol. 119, no. 3, p. 619-624, 1981. https://doi.org/10.1111/j.1432-1033.1981.tb05652.x
[2] C. Miller, G. Budoff, J. Prenner, & J. Schwarzbauer, Minireview: fibronectin in retinal disease, Experimental Biology and Medicine, vol. 242, no. 1, p. 1-7, 2016. https://doi.org/10.1177/1535370216675245
[3] P. Koistinen and J. Heino, The selective regulation of αvβ1 integrin expression is based on the hierarchical formation of αv-containing heterodimers, Journal of Biological Chemistry, vol. 277, no. 27, p. 24835-24841, 2002. https://doi.org/10.1074/jbc.m203149200
[4] S. Blystone, I. Graham, F. Lindberg, & E. Brown, Integrin alpha v beta 3 differentially regulates adhesive and phagocytic functions of the fibronectin receptor alpha 5 beta 1., The Journal of Cell Biology, vol. 127, no. 4, p. 1129-1137, 1994. https://doi.org/10.1083/jcb.127.4.1129
[5] Q. Zhang, T. Sakai, J. Nowlen, I. Hayashi, R. Fässler, & D. Mosher, Functional β1-integrins release the suppression of fibronectin matrix assembly by vitronectin, Journal of Biological Chemistry, vol. 274, no. 1, p. 368-375, 1999. https://doi.org/10.1074/jbc.274.1.368
[6] J. Hang, E. Zemskov, L. Lóránd, & A. Belkin, Identification of a novel recognition sequence for fibronectin within the nh2-terminal β-sandwich domain of tissue transglutaminase, Journal of Biological Chemistry, vol. 280, no. 25, p. 23675-23683, 2005. https://doi.org/10.1074/jbc.m503323200

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Fibronectins bind cell surfaces and various compounds including collagen, fibrin, heparin, DNA, and actin. Fibronectins are involved in cell adhesion, cell motility, opsonization, wound healing, and maintenance of cell shape. Involved in osteoblast compaction through the fibronectin fibrillogenesis cell-mediated matrix assembly process, essential for osteoblast mineralization. Participates in the regulation of type I collagen deposition by osteoblasts.; Binds fibronectin and induces fibril formation. This fibronectin polymer, named superfibronectin, exhibits enhanced adhesive properties. Both anastellin and superfibronectin inhibit tumor growth, angiogenesis and metastasis. Anastellin activates p38 MAPK and inhibits lysophospholipid signaling.
Gene References into Functions
  1. Evidence has been presented for FN modification by inflammatory oxidants, and particularly myeloperoxidase (MPO)-derived species including hypochlorous acid (HOCl). Studies using primary human coronary artery smooth muscle cells show that exposure to HOCl-modified FN, results in decreased adherence, increased proliferation and altered expression of genes involved in extracellular matrix synthesis and remodelling. PMID:30237127
  2. Depletion of FN1 by siRNA knockdown markedly reduced the invasive capacity of prostate cancer cells in vitro. PMID:29391407
  3. Human IL-7 binds more strongly to stretched than to relaxed Fibronectin. PMID:28845674
  4. TGFB1-mediated PI3K/Akt and p38 MAP kinase dependent alternative splicing of fibronectin extra domain A in human podocyte culture has been reported. PMID:29729706
  5. The findings of this study provide evidence highlighting the prominent role played by FN1 in stimulating glioma growth, invasion, and survival through the activation of the PI3K/AKT signaling pathway. PMID:30048971
  6. The simultaneous delivery of multiple proinflammatory payloads to the cancer site conferred protective immunity against subsequent tumor challenges. A fully human homolog of IL2-F8-TNF(mut), which retained selectivity similar to its murine counterpart when tested on human material, may open new clinical applications for the immunotherapy of cancer. PMID:28716814
  7. Under the same condition, p53 protein expression, but not mRNA expression, was reversed by MG132. Taken together, our data demonstrate that the level of FN expression is associated with the status and expression of p53 in breast cancer cells PMID:28765903
  8. Our study thus demonstrates the dual roles of PTHrP on TGF-b1 signaling and FN up-regulation for the first time in glomerular mesangial cells . These data also provided new insights to guide development of therapy for diabetic kidney disease PMID:28954822
  9. data suggest that miR-200b regulates EMT of chemo-resistant breast cancer cells by targeting FN1. miR-200b-based therapy may be an effective strategy in treating advanced breast cancer patients. PMID:28972876
  10. Identification of novel integrin-binding domain mutations in FN1 in patients with glomerulopathy with fibronectin deposits. PMID:27056061
  11. Fibronectin fragments (FNFr) function as matrikines driving the chemotactic affinity of prostate cancer cells via the alpha5beta1 integrin. PMID:27715399
  12. Fn with its inactive compact structure requires unfolding to assemble into active fibrils. Shear stress could induce conformational changes of plasma Fn. PMID:29470988
  13. B. burgdorferi does not primarily target insoluble matrix Fn deposited on endothelial surfaces but, instead, recruits and induces polymerization of soluble plasma Fn (pFn), an abundant protein in blood plasma that is normally soluble and nonadhesive. PMID:28396443
  14. miR1271 inhibited glioma cell growth by targeting FN1, and a low level of miR1271 in glioma tumor tissues was associated with lower survival rates in patients with glioma. PMID:28535003
  15. There is a significant association between a positive fetal fibronectin result and underlying inflammatory pathology of the placenta, even more so than the recognized relationship with short cervical length. PMID:28535404
  16. The article focuses on summarizing the many binding partners for fibronectin such as extracellular matrix proteins, growth factors, and synthetic binding partners with a particular interest in binding partners whose adhesiveness is impacted by the molecular conformation of the fibronectin fibers. (Review) PMID:27496349
  17. FN1 fibrils regulate TGFB1-induced epithelial-mesenchymal transition. PMID:28109697
  18. Breast cancer cells alter the dynamics of stromal fibronectin-collagen interactions. PMID:27503584
  19. This study suggested that high a1-antitrypsin (AAT)expression might be a negative prognostic marker for lung adenocarcinoma. AAT promoted lung adenocarcinoma metastasis, whose functional target may be fibronectin . Our findings provide new insight into the mechanisms of lung adenocarcinoma metastasis PMID:28440399
  20. Data show the expression of ED-B fibronectin was much higher in mesenchymal than prostate cancer cells even after the epithelial to mesenchymal transition. Epithelial to mesenchymal transition is a key step for tumor progression contributing to the metastatic spread. Therefore, circulating cancer cells could seed into the metastatic niche taking advantage from the ED-B fibronectin that secrete their own. PMID:27902486
  21. Thrombomodulin (TM) promotes angiogenesis by enhancing cell adhesion, migration, and FAK activation through interaction with fibronectin. PMID:27602495
  22. thyroid nodule stiffness is correlated with fibrosis and expression of Gal-3 and FN-1 PMID:27809694
  23. EGF and TNFalpha cooperatively promoted the motility of HCC cells mainly through NF-kappaB/p65 mediated synergistic induction of FN in vitro. These findings highlight the crosstalk between EGF and TNFalpha in promoting HCC, and provide potential targets for HCC prevention and treatment. PMID:28844984
  24. analysis of FN in breast cancer reveals its role and diagnostic potential PMID:27250024
  25. RT-PCR together with Sanger sequencing verified the presence of the FN1-ALK fusion transcripts PMID:27469327
  26. Fibronectin is readily modified by ONOOH at low (physiologically-relevant) molar ratios of oxidant to protein. PMID:27396946
  27. The 45 kDa gelatin-binding domain of fibronectin is responsible for the binding to TGM2. PMID:27394141
  28. Proteomics study showed a strong association of FN1, A2M, C4BPA and CFB in molecular subtypes of breast cancer. The findings also revealed the altered level expressions of these selected proteins could classify BC subtypes through plasma and tissue based expression analysis PMID:27498393
  29. FN1/CCL2 levels are elevated in the bronchoalveolar lavage fluid from pulmonary sarcoidosis patients. PMID:27259755
  30. Cancer-associated fibroblasts organize the fibronectin matrix and promote directional prostate cancer cell migration. PMID:29021221
  31. FN1 mutations that cause defective fibronectin secretion are found in SMD. PMID:29100092
  32. FN1 overexpression is an important determinant of thyroid cancer aggressiveness. PMID:27173027
  33. Thyroid hormone T3 induces fibronectin and HIF-1alpha synthesis via PI3K/AKT signaling pathway. PMID:28974422
  34. Mutations in FN are associated with glomerulopathy, but when we studied mutant proteins, the single-nucleotide mutations had only minor effects on conformation and matrix assembly. The mutations may destabilize their FNIII domains or generate dimers of dimers by disulfide cross-linking. PMID:28745050
  35. Fibronectin and Hepatocyte Growth Factor were shown to be produced by lung fibroblasts and, furthermore, to enhance malignant pleural mesothelioma cell migration and invasion PMID:28476806
  36. Study identifies four likely Tourette disorder risk genes with multiple de novo damaging variants in unrelated probands: WWC1 (WW and C2 domain containing 1), CELSR3 (Cadherin EGF LAG seven-pass G-type receptor 3), NIPBL (Nipped-B-like), and FN1 (fibronectin 1). PMID:28472652
  37. fibrillar fibronectin on this polymer, but not a globular conformation obtained on control polymers, promotes synergistic presentation of integrin-binding sites and bound bone morphogenetic protein 2 (BMP-2), which enhances mesenchymal stem cell osteogenesis in vitro and drives full regeneration of a nonhealing bone defect in vivo at low GF concentrations. PMID:27574702
  38. Fn plays a critical role in inflammasome-activated cells by amplifying caspase-1 activation and inducing inflammatory cell death. PMID:27870323
  39. If the expression of Capon is decreased, myeloma cells are adhered to fibronectin or bone marrow stromal cells (bone marrow mesenchymal stem cells). In addition, the sensitivity of the cell line to chemotherapeutic agents was reduced after silencing Capon in the myeloma cell line which was adhered to bone marrow mesenchymal stem cells. PMID:28671047
  40. Protease sensitivity resulting from mutations in the Fn-binding sequence could lead to degradation of type I collagen, early embryonic lethality PMID:27799304
  41. C-terminal truncation of transglutaminase 2 (TG2) reduces binding to the small intestinal extracellular matrix (ECM) despite retained fibronectin (FN)-binding capacity. PMID:27685605
  42. analysis of novel functions for two fibronectin isoforms and the mediating receptors in osteoblast differentiation PMID:28325836
  43. In vitro binding assays with purified components reveal that Tie-integrin recognition is direct, and further demonstrate that the receptor binding domain of the Tie2 ligand Ang-1, but not the receptor binding domain of Ang-2, can independently associate with a5b1 or aVb3. cooperative Tie/integrin interactions selectively stimulate ERK/MAPK signaling in the presence of both Ang-1 and fibronectin PMID:27695111
  44. Results directly implicate the heparin-binding sequence of the first type III repeat of fibrillar fibronectin (FNIII1) in realignment of stress fibers in HUVECs and, importantly, show that the matricryptic heparin-binding RWRPK sequence located in FNIII1 is required for the response. PMID:27521419
  45. TGFbeta elevated the expression of CamK IIbeta and CamK IIdelta, while siRNA silencing of those two subtypes significantly reduced TGFbeta-mediated expression of collagen A1 and fibronectin 1. PMID:28130256
  46. Findings suggest that the up-regulated level of EDA+ FN is associated with liver damage in nonalcoholic fatty liver disease. PMID:28397039
  47. In vitro binding studies support a previously unreported two-state "catch-clamp" mechanism of Fn binding by CshA, in which the disordered N-terminal domain of CshA acts to "catch" Fn, via formation of a rapidly assembled but also readily dissociable pre-complex, enabling its neighboring ligand binding domain to tightly clamp the two polypeptides together. PMID:27920201
  48. These data add new evidence that thermodynamic stability correlates primarily with unfolding rate rather than folding rate. The study also has implications for the question of whether opening of FNIII domains contributes to the stretching of fibronectin matrix fibrils. PMID:27909052
  49. A positive fFN was associate with preterm birth <32 weeks (15.6% versus 4.2%, p = 0.043), <35 weeks (37.5% versus 11.1%, p = 0.002), <37 weeks (65.6% versus 20.8%, p < 0.001), and earlier gestational ages at delivery (35.2 +/- 3.9 versus 37.4 +/- 2.9, p = 0.001). PMID:26782923
  50. FN1 plays a role in the development of cisplatin resistance in non-small cell lung cancer (NSCLC), possibly by modulation of beta-catenin signaling through interaction with integrin-beta1 in NSCLC. PMID:27207836

Show More

Hide All

Subcellular Location
Secreted, extracellular space, extracellular matrix.
Tissue Specificity
Expressed in the inner limiting membrane and around blood vessels in the retina (at protein level). Plasma FN (soluble dimeric form) is secreted by hepatocytes. Cellular FN (dimeric or cross-linked multimeric forms), made by fibroblasts, epithelial and ot
Database Links

HGNC: 3778

UNIGENE: Hs.203717

KEGG: hsa:2335

OMIM: 135600

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products