Purity
>85% as determined by SDS-PAGE.
Alternative Names
ER BETA; ER-beta; Erb; ESR B; ESR BETA; ESR2; ESR2_HUMAN; ESRB; ESTRB; estrogen nuclear receptor beta variant a; estrogen nuclear receptor beta variant b; estrogen receptor 2 (ER beta); Estrogen receptor 2; estrogen receptor beta 4; Estrogen receptor beta; NR3A2; Nuclear receptor subfamily 3 group A member 2
Species
Homo sapiens (Human)
Expression Region
2-323AA of Isoform 3
Target Protein Sequence
DIKNSPSSLNSPSSYNCSQSILPLEHGSIYIPSSYVDSHHEYPAMTFYSPAVMNYSIPSNVTNLEGGPGRQTTSPNVLWPTPGHLSPLVVHRQLSHLYAEPQKSPWCEARSLEHTLPVNRETLKRKVSGNRCASPVTGPGSKRDAHFCAVCSDYASGYHYGVWSCEGCKAFFKRSIQGHNDYICPATNQCTIDKNRRKSCQACRLRKCYEVGMVKCGSRRERCGYRLVRRQRSADEQLHCAGKAKRSGGHAPRVRELLLDALSPEQLVLTLLEAEPPHVLISRPSAPFTEASMMMSLTKLADKELVHMISWAKKIPGMRGNA
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Partial of Isoform 3
Tag Info
N-terminal 6xHis-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description
The expression region of this recombinant Human ESR2 covers amino acids 2-323. This ESR2 protein is expected to have a theoretical molecular weight of 39.8 kDa. This protein is generated in a e.coli-based system. The ESR2 gene fragment has been modified by fusing the N-terminal 6xHis tag, providing convenience in detecting and purifying the recombinant ESR2 protein during the following stages.
Human estrogen receptor beta (ESR2) is a nuclear hormone receptor that plays a crucial role in mediating the physiological effects of estrogen. It is a member of the steroid hormone receptor superfamily and is expressed in various tissues, including the reproductive, cardiovascular, and central nervous systems. ESR2 functions as a transcription factor, regulating gene expression in response to estrogen binding. Its activation influences diverse processes such as cell proliferation, differentiation, and apoptosis. ESR2 is particularly involved in modulating the effects of estrogen in non-reproductive tissues. Research on ESR2 has implications for understanding hormone-dependent diseases, including certain cancers and exploring therapeutic interventions related to hormonal regulation.