Abbreviation
Recombinant Human CTLA4 protein, partial (Active)
Purity
Greater than 90% as determined by SDS-PAGE.
Greater than 90% as determined by SEC-HPLC.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized CD152 at 2 μg/ml can bind Anti-CD152 rabbit monoclonal antibody(CSB-RA213310A0HU), the EC50 of human CD152 protein is 27.14-34.82 ng/ml.
Alternative Names
CTLA4; CD152; Cytotoxic T-lymphocyte protein 4; Cytotoxic T-lymphocyte-associated antigen 4; CTLA-4; CD antigen CD152
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
37-162aa
Target Protein Sequence
AMHVAQPAVVLASSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYLGIGNGTQIYVIDPEPCPDSDF
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
C-terminal hFc1-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Storage
Store at -20°C/-81°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Shelf Life
The shelf life is related to many factors, storage state, storage temperature and the stability of the product itself. Generally, the shelf life of lyophilized form is 6 months at -20°C/-80°C from the date of receipt.
Datasheet & COA
Please contact us to get it.
Description
CTLA-4 serves as a critical immune checkpoint receptor whose extracellular domain (aa 37–162) mediates the competitive binding to CD80/CD86 that suppresses T-cell activation—making it a central target in immuno-oncology drug development. This recombinant human CTLA-4 construct, expressed in mammalian cells with a C-terminal hFc1 tag, preserves native glycosylation and disulfide-dependent folding essential for conformationally sensitive ligand-receptor interactions. Functional ELISA confirms robust binding activity, with an EC50 of 27.14–34.82 ng/ml against an anti-CD152 monoclonal antibody, supporting use in blocking antibody screening, therapeutic antibody epitope mapping, checkpoint receptor-ligand interaction assays by SPR or BLI, and small-molecule inhibitor discovery campaigns. Purity exceeding 90% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the quality thresholds commonly required for cell-based functional assays and quantitative affinity characterization studies.