Recombinant Human Cysteine protease ATG4B (ATG4B)

Code
MSDS
Size Pls inquire
Source
Conjugate
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
ATG4B
Uniprot NO.
Alternative Names
Cysteine protease ATG4B; EC 3.4.22.-; AUT-like 1 cysteine endopeptidase; Autophagy-related cysteine endopeptidase 1; Autophagin-1; Autophagy-related protein 4 homolog B; HsAPG4B; hAPG4B; ATG4B APG4B AUTL1 KIAA0943
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
1-393
Target Protein Sequence
MDAATLTYDTLRFAEFEDFPETSEPVWILGRKYSIFTEKDEILSDVASRLWFTYRKNFPAIGGTGPTSDTGWGCMLRCGQMIFAQALVCRHLGRDWRWTQRKRQPDSYFSVLNAFIDRKDSYYSIHQIAQMGVGEGKSIGQWYGPNTVAQVLKKLAVFDTWSSLAVHIAMDNTVVMEEIRRLCRTSVPCAGATAFPADSDRHCNGFPAGAEVTNRPSPWRPLVLLIPLRLGLTDINEAYVETLKHCFMMPQSLGVIGGKPNSAHYFIGYVGEELIYLDPHTTQPAVEPTDGCFIPDESFHCQHPPCRMSIAELDPSIAVGFFCKTEDDFNDWCQQVKKLSLLGGALPMFELVELQPSHLACPDVLNLSLDSSDVERLERFFDSEDEDFEILSL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Protein Length
Full Length
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Cysteine protease required for the cytoplasm to vacuole transport (Cvt) and autophagy. Cleaves the C-terminal amino acid of ATG8 family proteins MAP1LC3, GABARAPL1, GABARAPL2 and GABARAP, to reveal a C-terminal glycine. Exposure of the glycine at the C-terminus is essential for ATG8 proteins conjugation to phosphatidylethanolamine (PE) and insertion to membranes, which is necessary for autophagy. Has also an activity of delipidating enzyme for the PE-conjugated forms.
Gene References into Functions
  1. ATG4B expression was observed markedly upregulated by EWS-FLI1 overexpression, and silencing of ATG4B dramatically inhibits autophagy in Ewing sarcoma cells. PMID:28902354
  2. study demonstrates that Rab7b regulates LC3 processing by modulating Atg4B activity; taken together, findings reveal Rab7b as a novel negative regulator of autophagy through its interaction with Atg4B PMID:28835545
  3. ATG4B contains a C-terminal LIR motif important for binding and efficient cleavage of mammalian orthologs of yeast Atg8 PMID:28287329
  4. O-GlcNAcylation of ATG4B regulates autophagy activation by increasing its proteolytic activity under metabolic stress condition PMID:27527864
  5. these results demonstrate a novel association of ATG4B positive expression with HER2 positive breast cancers PMID:27556700
  6. Knockdown of ATG4B had only a minor effect on AMPK activation and G1 phase arrest in liver kinase B1-deficient or AMPK-inhibited cancer cells. PMID:29169176
  7. Our work describes an MST4-ATG4B signaling axis that influences glioblastoma autophagy and malignancy PMID:29232556
  8. Data show that ULK1, a protein kinase activated at the autophagosome formation site, phosphorylates human ATG4B on serine 316. PMID:28821708
  9. Reporter assay showed that HSF1 increased the transcriptional activity of ATG4B gene promoter, and chromatin immunoprecipitation assay verified that HSF1 bound to the site (-1429 to -1417) in ATG4B gene promoter region. PMID:28889000
  10. The structure and regulatory machinery of Atg4b [review] PMID:28253956
  11. MIRlet-7i is able to regulate autophagic activity via regulating Atg4B expression, which might contribute to the pathogenesis of pre-eclampsia. PMID:27770612
  12. Results demonstrated that upregulation of miR-34a by transfection or demethylation resulted in the enhanced apoptosis and drug sensitivity in prostate cancer cells. ATG4B, directly regulated by miR-34a through AMPK/mTOR, was involved in this process. PMID:26499184
  13. Purified ATG4B protein interact with LC3B in vitro. PMID:25652856
  14. ATG4B independently plays a role as a positive regulator on tumor proliferation and a negative regulator on autophagy in colorectal cancer cells. PMID:24991826
  15. This study identifies ATG4B as a potential biomarker for predicting therapeutic response in treatment-naive chronic myeloid leukemia stem/progenitor cells and uncovers ATG4B as a possible drug target in these cells. PMID:24755409
  16. The actions of ATG4 family members (particularly ATG4B) are required for the control of autophagosome fusion with late, degradative compartments in differentiating human erythroblasts. PMID:23508006
  17. HsAtg4B negatively regulates the localization of LC3 to a membrane compartment by delipidation PMID:15187094
  18. analysis of specificity and catalysis of HsAtg4B PMID:16183633
  19. crystal structure of human Atg4b by X-ray crystallography at 2.0 A resolution, and show that Atg4b is a cysteine protease whose active catalytic triad site consists of Cys74, His280 and Asp278 PMID:16325851
  20. Murine Atg8L/Apg8L modification is mediated by human Atg4B. PMID:16704426
  21. The crystal structures of catalytically inert human Atg4B in complex with processed and unprocessed forms of LC3 showed that, on LC3 binding, the regulatory loop and the N-terminal tail of HsAtg4B undergo large conformational changes. PMID:19322194

Show More

Hide All

Subcellular Location
Cytoplasm.
Protein Families
Peptidase C54 family
Database Links

HGNC: 20790

UNIGENE: Hs.283610

KEGG: hsa:23192

STRING: 9606.ENSP00000384259

OMIM: 611338

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1