MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
19.7 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Buffer
Tris-based buffer,50% glycerol
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Interacts strongly with CDK4 and CDK6. Potent inhibitor. Potential effector of TGF-beta induced cell cycle arrest.
Gene References into Functions
Concurrent mutations, in genes such as CDKN2B or RB1, were associated with worse clinical outcome in lung adenocarcinoma patients with EGFR active mutations.PMID:29343775
CDKN2B expression in HPDE6-C7 human pancreatic ductal cells is induced by oncogenic KRAS via TGF-beta signaling.PMID:28892048
findings suggest that the GG genotype of the CDKN2B-AS1 gene variant rs4977574, which has been previously associated with an increased CAD risk, is also associated with a decreased susceptibility to the development of hypertensionPMID:29791233
CDKN2B gene locus is a cardiovascular risk in ethnic Saudi ArabsPMID:29894795
ANRIL plays an important role in the formation of atherosclerosis, and the artificial modification of ANRIL transcripts should be considered following the development of this disease. (Review)PMID:29270737
CDKN2A/B locus SNPs may impact T2D risk by modulating islet gene expression and beta-cell proliferation.PMID:29432124
Complete methylation and loss of p15 gene expression causes susceptibility to relapse and decreased survival in APL patients. Thus, p15 promoter hypermethylation is a prospective prognostic indicator and a reliable clinical aid in assessment of patients with APL.PMID:28052659
Patients with higher levels of DNA methylation of CDKN2B may bear increased risk for aortic arch calcificationPMID:27773886
E2F1 induces TINCR transcriptional activity and accelerates gastric cancer progression via activation of TINCR/STAU1/CDKN2B signaling axis.PMID:28569791
ANRIL may reduce p15INK4B expression through inhibiting TGF-beta/Smad signaling pathway, promoting invasion and metastasis of TC cells, and the silencing of ANRIL inhibits the invasion and metastasis of TPC-1 cellsPMID:27507052
The obtained data suggested a negative association between copy number variation of the CDK2B genes and Atherothrombotic stroke.PMID:28477716
Among 8 SNPs in 3 loci that showed at least nominal association (P < 5.00E-02) in the primary cohort, a representative SNP for each loci (rs2157719 for CDKN2B-AS1, rs33912345 for SIX6, and rs9913911 for GAS7) were selectedPMID:29261660
Results show that expression of CDKN2B was reduced significantly in colorectal cancer (CRC) and its promotor is targeted by miR-18b which controls its regulation.PMID:28784723
Mechanistic investigations demonstrated that BLACAT1 had a key role in G1/G0 arrest, and showed that BLACAT1 can repress p15 expression by binding to EZH2, thus contributing to the regulation of CRC cell cycle and proliferation. Our results suggest that BLACAT1, as a cell cycle regulator, may serve as a potential target for colon cancer prevention and treatment in human CRCPMID:28277544
DNA methylation of CDKN2B may play a potential role in artery calcification.PMID:27905995
These data support the hypothesis that decreased p15 expression is a robust biomarker for distinguishing nevus from melanoma.PMID:27855847
Total 1208 differentially expressed genes were screened, and 5 coronary artery disease (CAD)-associated miRNAs (including miR-92a) were predicted associated with CAD. The SVM classifier was constructed based on the 41 featured genes and had high recognition efficiency. Only one lncRNA CDKN2B-antisense targeting miR-92a was obtained.PMID:28760552
Upregulation of ZEB1-AS1 colorectal cancer promotes cell proliferation and inhibits cell apoptosis. In addition, cell cycle inhibitory protein p15 participates in the oncogenic function of ZEB1-AS1. Collectively, ZEB1-AS1 has asignificant effect on colorectal cancer pathological process and serves as a valuable prognostic biomarker for colorectal cancer.PMID:28618933
Genetic association analyses using the cpRNFLT with 768 points suggest that the CDKN2B gene was associated with paracentral/lower hemifield scotomas.PMID:28472212
We found that CDKN2B was a virtual target of miR-15a-5p with potential binding sites in the 3'UTR of CDKN2B (77-83 bp). We also showed that miR-15a-5p could bind to the CDKN2B 3'UTR. The data revealed a negative regulatory role of miR-15a-5p in the apoptosis of smooth muscle cells via targeting CDKN2B, and showed that miR-15a-5p could be a novel therapeutic target of AAA.PMID:28214350
Meta-analysis indicates that CDKN2B gene rs1063192 polymorphism is significantly associated with a decreased risk of glaucoma. [meta-analysis]PMID:28416752
results suggest that the cyclin dependent kinase inhibitor 2B rs10811656 locus might be associated with coronary artery disease in a Chinese Han populationPMID:27507036
Polymorphism rs1063192 in CDKN2B is not a risk factor for Open-Angle Glaucoma in Saudi cohort.PMID:27541204
The CC genotype of CDKN2B rs1063192 in the hsa-miR-323b-5p binding site increased the risk of gestational diabetes mellitus in pregnant Chinese Han womenPMID:25990668
Genetic risk variants in the CDKN2B gene is associated with somatic biomarkers in glioma.PMID:26839018
Aberrant methylation of the promoter regions of the p15INK4b gene in patients with acute myeloid leukemias.PMID:27459612
Inhibited HO-1 expression attenuated the hypermethylation of CDKN2B by suppressing DNMT1, which was conducive to treatment by cooperating with decitabine.PMID:26782424
Tumor suppressor ASXL1 is essential for the activation of INK4B expression in response to oncogene activity and anti-proliferative signalsPMID:26470845
This study investigated the potential roles of CDKN2B-related piRNA in leukemia cells to provide a potential tumorigenesis model of leukemiaPMID:26205624
CDKN2B Loss Promotes Progression from Benign Melanocytic Nevus to MelanomaPMID:26183406
Children with ALL have higher levels of p15 CpG island methylation than a control group of children with ITP.PMID:26501552
High expression of p15 antisense RNA is associated with acute myeloid leukemia.PMID:27060304
CDKN2B variants are associated with pediatric B-cell precursor acute lymphoblastic leukemia.PMID:26868379
Loss of CDKN2B may not only promote cardiovascular disease through the development of atherosclerosis but may also impair TGFbeta signaling and hypoxic neovessel maturation.PMID:26596284
CD93 regulates LSC self-renewal by silencing CDKN2B in MLL leukemiaPMID:26387756
The treatment of Raji cell line with 10 muM curcumin caused hypomethylation of the p15 promoter after six days. This led to the up-regulation of p15 and down-regulation of DNA methyltransferase 1.PMID:26333125
Findings identify germline CDKN2B mutations as a novel cause of familial renal cell carcinoma.PMID:25873077
There was no association between germline coding CDKN2B variants and B cell acute lymphoblastic leukemia in children.PMID:26104880
Results show that ANRIL positively regulates the proliferation of cancer cells, via regulating p15 and other genes related to G2/M phase control.PMID:26408699
these data show that DC-SCRIPT acts as a novel regulator of CDKN2B and induces cell cycle arrest in ESR1-positive breast cancer cells.PMID:25663546
silencing of p15 gene expression by epigenetic modification such as promoter hypermethylation plays a role not only in the initiation of multiple myeloma but also in plasma cell malignant transformation, disease progression, and developmentPMID:25382971
promoter methylation of p15 gene could have prognostic value in diffuse large B-cell lymphoma patients.PMID:24815848
CDKN2B locus deletion is associated with melanoma brain metastases.PMID:24968695
genotypes of the polymorphic markers of KCNJ11, SLC30A8 and CDKN2B genes showed the presence of association with T2DM in Russian population, while for the FTO gene was not found statistically significant associations with type 2 diabetesPMID:25916116
CDKN2B polymorphism is associated with the development of coronary atherosclerosis.PMID:24573017
Single nucleotide polymorphisms in CDKN2B gene are associated with cancer.PMID:25239644
Exogenous p15 protein expression combined with STI571 appeared to have a synergistic effect on proliferation inhibition and apoptosis induction in K562 cells.PMID:24938701
Investigate the relationship between urinary nickel and methylation of p16 in workers exposed to nickel. The levels of urinary nickel were significantly associated with the methylation of p15.PMID:24806561
CDKN2B upregulation was found in myelodysplastic syndrome mesenchymal stem cells.PMID:24943834
Loss of p15INK4b was associated with older age.PMID:24716938
Show
More
Hide
All
Subcellular Location
Cytoplasm. Note=Also found in the nucleus.
Protein Families
CDKN2 cyclin-dependent kinase inhibitor family
Tissue Specificity
Isoform 2 is expressed in normal (keratinocytes, fibroblasts) and tumor cell lines.