Recombinant Human Complement receptor type 1 (CR1), partial

In Stock
Code: CSB-EP005932HU
Size:
20ug
20ug100ug1mg(1mg*1 or 500ug*2)
US$224
Quantity:
Express system: E.coli
Species: Homo sapiens (Human)
Tag Info: N-terminal GST-tagged
For inquiries on large quantities or another requirements
Send an Inquiry
Start an on-line Chat
Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
CR1
Uniprot NO.
Alternative Names
C3 binding protein; C3b/C4b receptor; C3BR; C4BR; CD 35; CD35; CD35 antigen; complement component (3b/4b) receptor 1 (Knops blood group); complement component (3b/4b) receptor 1 including Knops blood group system; Complement component receptor 1; Complement receptor 1; Complement receptor type 1; CR 1; CR1; CR1_HUMAN; KN; Knops blood group antigen
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
41-234aa
Target Protein Sequence
GQCNAPEWLPFARPTNLTDEFEFPIGTYLNYECRPGYSGRPFSIICLKNSVWTGAKDRCRRKSCRNPPDPVNGMVHVIKGIQFGSQIKYSCTKGYRLIGSSSATCIISGDTVIWDNETPICDRIPCGLPPTITNGDFISTNRENFHYGSVVTYRCNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCII
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
48.4kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Troubleshooting and FAQs
Datasheet & COA
Please contact us to get it.
Images
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP005932HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CR1.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP005932HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) CR1.
Description

This Recombinant Human Complement receptor type 1 (CR1) is produced using an E.coli expression system, covering amino acids 41 to 234. The protein appears to be partially expressed and includes an N-terminal GST tag, which makes purification and detection more straightforward. Purity levels exceed 90%, as confirmed by SDS-PAGE analysis, suggesting it should work reliably in experimental settings. Endotoxin levels remain minimal, making it appropriate for research applications.

Complement receptor type 1 (CR1) seems to play a crucial role in immune system function by helping clear immune complexes and regulating complement activation. The receptor is involved in both classical and alternative complement pathways, likely protecting host tissues from damage during immune responses. CR1 has drawn considerable attention in studies of various immune-related conditions, which may explain why it's become such a valuable target in immunological research.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant Human CR1 fragment is expressed in E. coli, a prokaryotic system that is generally unsuitable for producing functional eukaryotic extracellular domain proteins. CR1 is a complex transmembrane protein requiring proper folding, glycosylation, and domain organization for its complement-binding functions. The expressed fragment (41-234aa) is partial and lacks the full extracellular domain structure, while the large N-terminal GST tag (∼26kDa) may significantly interfere with proper folding of the CR1 domain. E. coli cannot provide the necessary post-translational modifications (e.g., glycosylation) required for CR1's native conformation. Since activity is explicitly unverified, the protein is highly likely to be misfolded and inactive for its natural complement-binding functions.

1. GST Pull-Down Assays for Protein-Protein Interaction Studies

The N-terminal GST tag technically enables pull-down experiments through glutathione-sepharose binding. However, if the CR1 fragment is misfolded (as expected in E. coli), it will not display native conformational epitopes needed for physiological interactions with complement components or signaling partners. Identified interactions may be non-specific or artifactual. This application should not be used for biological discovery without prior validation of proper folding and activity.

2. Antibody Development and Epitope Mapping

This application is appropriate with caveats. The recombinant CR1 fragment can serve as an immunogen for generating antibodies that recognize linear epitopes within the 41-234aa region. The high purity (>90%) supports immunization protocols. However, if the protein is misfolded, antibodies may not recognize conformational epitopes of native, fully-glycosylated CR1 on cell surfaces. Antibodies should be validated against native CR1 from human cells or tissues.

3. Biochemical Characterization and Biophysical Analysis

This application is well-suited and should be prioritized. Techniques like circular dichroism spectroscopy, size exclusion chromatography, and dynamic light scattering can directly assess the protein's folding state, oligomerization, and stability. These studies are valuable even if the protein is inactive, as they characterize the recombinant product itself. The GST tag may influence the results but can be accounted for in analyses.

4. GST-Tagged Protein Purification Method Development

This application is technically feasible. The GST-CR1 fusion protein can be used as a model system for optimizing E. coli expression and purification protocols for difficult-to-express extracellular domain fragments. However, methods developed using this potentially misfolded protein may not translate well to producing functional CR1 domains. The application has limited biological relevance but can be useful for technical methodology development.

Final Recommendation & Action Plan

Given the high probability of misfolding due to E. coli expression and the large GST tag, this CR1 fragment is primarily suitable for antibody development (with validation against native protein) and biochemical characterization studies. Avoid biological interaction studies (pull-down assays) until proper folding is confirmed. Recommended first steps: 1) Perform biophysical characterization (size exclusion chromatography, circular dichroism) to assess folding state; 2) If possible, test binding to known CR1 ligands (e.g., C3b/C4b) with positive controls; 3) For antibody production, use the protein as immunogen but validate resulting antibodies against native CR1; 4) Consider alternative expression systems (e.g., mammalian cells) for producing functional CR1 domains. The current protein may serve as a negative control in studies requiring properly folded CR1.

Customer Reviews and Q&A

 Customer Reviews

Target Background

Function(From Uniprot)
Membrane immune adherence receptor that plays a critical role in the capture and clearance of complement-opsonized pathogens by erythrocytes and monocytes/macrophages. Mediates the binding by these cells of particles and immune complexes that have activated complement to eliminate them from the circulation. Acts also in the inhibition of spontaneous complement activation by impairing the formation and function of the alternative and classical pathway C3/C5 convertases, and by serving as a cofactor for the cleavage by factor I of C3b to iC3b, C3c and C3d,g, and of C4b to C4c and C4d. Plays also a role in immune regulation by contributing, upon ligand binding, to the generation of regulatory T cells from activated helper T cells.; (Microbial infection) Acts as a receptor for Epstein-Barr virus.
Gene References into Functions
  1. this study correlated phenotype data (CR1 density per erythrocyte (CR1/E), blood soluble CR1 (sCR1)) with genetic data (density/length polymorphisms) in AD patients and healthy controls.. PMID:30044434
  2. CR1 rs1704660G, rs17047661G and rs6691117G variants were significantly associated with Chagas disease. PMID:29323238
  3. Meta-analysis validated the association of late onset Alzheimer disease with CR1 (rs6656401) variants. PMID:29504051
  4. rs6656401 CR1 is not associated with late-onset Alzheimer's disease. PMID:28477215
  5. CR1 plays a vital role in Alzheimer's disease pathology and disease progression. PMID:26742530
  6. the effect of CR1 rs3818361 polymorphism on Alzheimer's disease (AD) risk in Chinese cohorts is consistent with the increased risk observed in European AD cohorts. PMID:26189835
  7. Genetic variation within the CR1 gene is associated with inflammation and the risk of incident coronary artery disease. PMID:28033544
  8. The distribution of the CR1 alleles, genotypes and haplotypes differed significantly among population in Brazil, Vietnam, India, Republic of Congo and Ghana. PMID:28520715
  9. CD16 and CD35 are important for neutrophil internalization of M. tuberculosis, whereas HIV-1 infection adversely affects opsonophagocytosis. PMID:27258232
  10. This study demonstrates an up-regulation of complement regulatory proteins, CD35 and CD55 in HIV associated pre-eclamptic compared to normotensive pregnancy. PMID:27521598
  11. Although B lymphocytes of active systemic lupus erythematosus (SLE) patients express lower level of CR1, the inhibitory capacity of this complement receptor is still maintained and its ligand-induced clustering results in significant inhibition of the main B cell functions, similar to that found in the case of healthy individuals. PMID:27981054
  12. CyaA binding did not trigger downstream signaling of CR3 in human monocytes and CyaA-catalyzed elevation of cAMP effectively blocked CR3 signaling initiated by a natural ligand. PMID:26650353
  13. the Putative Role of CR1 in Alzheimer's Disease PMID:26914463
  14. Knops blood group antigen a/b genotype was associated with increased susceptibility to severe malaria and the b/b genotype was associated with reduced risk of severe malaria. PMID:25916414
  15. The C4d/CR1 ratio is a simple and quickly determinable biomarker that enables the differentiation between infection and flare-up in febrile SLE patients at initial evaluation. PMID:26273660
  16. This meta-analysis further supports previous findings that CR1 rs6656401 polymorphism contributes to Alzheimer's Disease susceptibility. PMID:24878768
  17. Complement receptor type 1 (CR1/CD35) expressed on activated human CD4+ T cells contributes to generation of regulatory T cells PMID:25742728
  18. These results provide a framework for understanding how loss of CR1 expression on podocytes may contribute to complement-mediated damage in the kidney. PMID:26260209
  19. findings provide evidence that the A carrier (AG/GG) and the A allele of the ECR1 A3650G polymorphism may be correlated to the pathogenesis of NRDS and, hence, might be involved in the susceptibility to NRDS. PMID:25494101
  20. THE COMBINATION OF EXPRESSION OF MARKERS CR1 AND CR2 (CD35/CD21) IN DIAGNOSTIC OF B-CELL LYMPHOPROLIFERATIVE DISEASES PMID:26189291
  21. CR1 gene rs2274567 G/A, rs4844600 G/A, and rs2296160 C/T polymorphisms may not be involved in susceptibility to malaria in Chinese population. PMID:25683978
  22. In addition to being a risk factor for Alzheimer's disease development, a CR1 SNP appears to be associated with higher rates of medium-term disease progression PMID:24998857
  23. Data indicate that complement activation promote complement component 3 C3b deposition on native and acetylated LDL and binding to the complement receptor 1 (CR1). PMID:25349208
  24. A meta-analysis demonstrated significant associations of both the CR1 rs6656401 and CR1 rs3818361 polymorphisms with late-onset Alzheimer's disease susceptibility. PMID:24996192
  25. CR1 SNPs correlates with specific aspects of cognitive impairment in Alzheimer's disease patients. PMID:24530172
  26. This study identified nominally significant or suggestive associations between the LOAD-risky CR1 variants and worse Logical Memory immediate recall scores in blacks. PMID:23643458
  27. Increased CR1 expression was associated with histology classification. PMID:23464487
  28. CR1 rs7525160 G > C polymorphism was associated with an increased risk of developing non-small cell lung cancer in Chinese population PMID:24621201
  29. Polymorphism of the complement receptor 1 gene correlates with the hematologic response to eculizumab in patients with paroxysmal nocturnal hemoglobinuria. PMID:24038027
  30. this is the first study to elucidate the relationship of the L-CR1 transcript with the disease activity of RA patients. PMID:24433281
  31. Using mutagenesis and structural biology to map the binding site for the Plasmodium falciparum merozoite protein PfRh4 on the human immune adherence receptor. PMID:24214979
  32. Maternal coding variants in complement receptor 1 is associated with spontaneous idiopathic preterm birth. PMID:23591632
  33. two Alzheimer's disease-associated CR1 variants, rs6656401 and rs3818361, are associated with major recurrent depression in females in a population-based cohort using individuals from the Generation Scotland: Scottish Family Health Study PMID:22244847
  34. It did not explain (part of) the association of genome wide association top single-nucleotide polymorphisms rs3818361/rs6656401, nor of the CR1copy number variation, with Alzheimer disease in our cohort PMID:23582656
  35. ATP release following CR1 ligation increases the mobility of the lipid fraction of RBC membranes, which in turn facilitates CR1 clustering, and thereby enhances the binding avidity of complement-opsonized particles to the RBC CR1. PMID:24022490
  36. Data show that increased CD35, CD46, CD55 and CD59 on neutrophils and monocytes present potent markers of bacterial infection and viral infection. PMID:23376460
  37. The CD35 antigen bounds gp350/220 and became latently infected when the fusion receptor HLA II was coexpressed. PMID:23416052
  38. Genome-wide association studies found 3 new susceptibility loci for Alzheimer disease(AD): complement receptor 1,clusterin,and the phosphatidylinositol-binding clathrin assembly protein. These SNPS are not associated with AD in a Polish population. PMID:23650005
  39. Our findings suggest complex mechanisms underlying the interaction of CR1, APOE, and brain amyloid pathways in Alzheimer disease PMID:23022416
  40. Complement receptor type 1 (CR1, CD35) is a potent inhibitor of B-cell functions in rheumatoid arthritis patients. PMID:22962438
  41. We identified rare small events overlapping CR1 and BIN1 in Alzheimer's disease and normal controls with opposite copy number variation dosage. PMID:23202439
  42. Malaria inhibits surface expression of complement receptor 1 in monocytes/macrophages, causing decreased immune complex internalization. PMID:23440418
  43. There are fewer mono- or dinucleated, but dramatically more numbers of tri- or polynucleated megakaryocytes in the bone marrow of transgenic Crry mice. PMID:23390291
  44. Common CR1 variants significantly protect against severe malaria in an endemic area. PMID:23152904
  45. In conclusion, despite there are some limitations, this meta-analysis indicates that the A allele of the CR1 SNP rs6656401 is significantly associated with LOAD susceptibility in Chinese Han populations. PMID:22960360
  46. The clustering phenomenon of CR1 in erythrocytes is identified in electron microscopy. PMID:22374251
  47. our results support that the CR1-S isoform explains the GWAS signals and open a novel prospect for the investigation of CR1-related disease mechanisms. PMID:22819390
  48. Simultaneous quantitative analysis of CD64 and CD35 expression on neutrophils might be useful to distinguish between bacterial and viral infections in rheumatoid arthritis patients. PMID:22237765
  49. CR1 (CD35) and CR3 (CD11b/CD18) act in concert for phagocytosis of opsonized Francisella tularensis by human neutrophils. PMID:22888138
  50. CLU and CR1 were associated with more rapid cognitive decline. PICALM was associated with an earlier age at midpoint of cognitive decline. PMID:22952074

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Protein Families
Receptors of complement activation (RCA) family
Tissue Specificity
Present on erythrocytes, a subset of T cells, mature B cells, follicular dendritic cells, monocytes and granulocytes.
Database Links

HGNC: 2334

UNIGENE: Hs.334019

KEGG: hsa:1378

STRING: 9606.ENSP00000356016

OMIM: 120620

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Select 0 Products