Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
Basic complement C4C3 and PZP-like alpha-2-macroglobulin domain-containing protein 3
Species
Homo sapiens (Human)
Expression Region
1454-1744aa
Target Protein Sequence
EAPKVVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
N-terminal 6xHis-SUMO-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description
The expression region of this recombinant Human C4B covers amino acids 1454-1744. This C4B protein is theoretically predicted to have a molecular weight of 49.1 kDa. This C4B recombinant protein is manufactured in e.coli. The N-terminal 6xHis-SUMO tag was smoothly integrated into the coding gene of C4B, which enables a simple process of detecting and purifying the C4B recombinant protein in the following steps.
Complement C4-B (C4B) is a component of the complement system, a crucial part of the immune system involved in recognizing and eliminating pathogens. C4B is one of the isoforms of the C4 protein, which is encoded by the C4B gene located in the major histocompatibility complex (MHC) on chromosome 6. The complement system is activated through a cascade of proteolytic reactions, leading to the formation of C4b, which participates in immune responses, including opsonization, inflammation, and cell lysis. C4B, in conjunction with other complement components, contributes to the clearance of immune complexes and pathogens. Polymorphisms in the C4B gene have been associated with various autoimmune diseases, emphasizing the importance of C4B in immune regulation and homeostasis. Understanding the function and genetic variations of C4B is crucial for unraveling the complexities of immune responses and their implications for health and disease.
