Home
Product
Protein
Recombinant Proteins
Recombinant Human Collagen alpha-2 (VI) chain (COL6A2), partial

Recombinant Human Collagen alpha-2 (VI) chain (COL6A2), partial

Code: CSB-EP005752HU

Rate （N/A）
Review （0）

Size:

20μg100μg1mg(1mg*1 or 500ug*2)

US$306

Quantity:

Express system: E.coli

Species: Homo sapiens (Human)

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Send an Inquiry

Start an on-line Chat

Online ordering is currently available for U.S. customers only. For orders outside the U.S., please kindly submit an inquiry or start a chat with us.

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

COL6A2

Uniprot NO.

P12110

Research Area

Signal Transduction

Alternative Names

CO6A2_HUMAN; COL6A2; Collagen alpha 2(VI) chain; Collagen alpha-2(VI) chain; collagen type VI alpha 2; Collagen VI alpha 2 polypeptide; human mRNA for collagen VI alpha 2 C terminal globular domain; PP3610

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

941-1016aa

Target Protein Sequence

ELSFVFLTDGVTGNDSLHESAHSMRKQNVVPTVLALGSDVDMDVLTTLSLGDRAAVFHEKDYDSLAQPGFFDRFIR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

13.4 kDa

Protein Length

Partial

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.

Buffer

Tris-based buffer，50% glycerol

Storage Condition

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Troubleshooting and FAQs

Protein FAQs

Datasheet & COA

Please contact us to get it.

Images

(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Customer Reviews and Q&A

■ Customer Reviews

Submit a Review here

■ Q&A

The suitability to perform coating on well plate prior cell seeding. In particular I'm interesting in study Col6A1, Col6A2 and Col7 as free protein and see the effect of interaction with Glioma cells after therapy.
Do you know if your products are suitable for cell culture?
If yes, I would like to know which between the native proteins and recombinant proteins, should be used and in which buffer they should be diluted.

As CSB-EP005752HU expressed in an inclusion body, it may not suit customer's experiment.
CSB-MP005752HU is a secretory supernatant, and the protein produced by mammalian expression system is closer to the natural state, and it is highly likely to interact with eukaryotic cells. If the customer wants to use it for cell culture or cell interaction, please remark "Endotoxin Removal + Aseptic Processing" when placing an order.
For the corresponding buffer, we first suggest PBS or HEPES, then NTA buffer,
Theoretically, the interaction effect between glioblastoma and homologous human protein will be better, but we haven't carried out the relevant verification, so we can't guarantee to meet the needs of customers, they need to verify it themselves.

Target Background

Function(From Uniprot)

Collagen VI acts as a cell-binding protein.

Gene References into Functions

binding of collagen VI to NG2 is essential for the direction of tendon fibroblasts migration in vitro. PMID:26944560
Genetic study showed a missense mutation in COL6A2 (c.820 G>A, p.Gly268Ser) that causes a glycine substitution in the Gly-X-Y collagenous motif, at the beginning of the collagenous triple helical domain. The c.820 G>A mutation segregated in all the affected patients. PMID:27563703
Mutations in COL6A2 gene are associated with aberrant mitochondria in Bethlem myopathy. PMID:25533456
In UCMD, 8 mutations were identified in COL6A2 in Chinese patients. PMID:24801232
COL6A2 is overexpressed in Down syndrome-affected umbilical cords at early and term gestational ages. PMID:23452080
Homozygous COL6A2 mutation, p.Asp215Asn, was identified in both affected siblings. We conclude that the COL6A2 p.Asp215Asn mutation is likely to be responsible for PME (Progressive Myoclonus Epilepsy) in this family. PMID:23138527
A deletion within intron 1A of the COL6A2 gene, occurring in compound heterozygosity with a small deletion in exon 28, was identified in a BM patient. PMID:20302629
the C2A splice variant has a role in recessive COL6A2 C-globular missense mutations in Ullrich congenital muscular dystrophy PMID:20106987
The alpha2(VI) chain modulates matrix-metalloproteinase (MMP) availability by sequestering proMMPs in the extracellular matrix, blocking proteolytic activity. PMID:19698785
the C-terminal globular domain of COL6A2 is not essential for triple-helix formation but is critical for microfibrillar assembly in Ullrich congenital muscular dystrophy PMID:12218063
A case of Ullrich disease is associated with complete deficiency of collagen VI and compound heterozygous mutations in the collagen VI alpha 2 gene with absence of microfibrils on electron microscopy. PMID:12297580
Bethlem myopathy is an autosomal dominantly inherited myopathy with contractures, caused by mutations in COL6A1 gene, COL6A2 gene or COL6A3 gene. PMID:12374585
In Ullrich syndrome, a heterozygous G-to-A substitution at position +5 in intron 23 & the corresponding heterozygous 6-bp deletion in exon 26 which deleted 1 of the 2 tandem repeats of the sequence CATCGG in nt 2268-2273 & 2274-2279 in COL6A2 ORF. PMID:14981181
diminished COL6A2 mRNA expression found to be primary pathogenic mechanism in UCMD patient PMID:16075202
This study demonstrates a homogenoeous overexpression of the genes encoding for alpha1 and alpha2 chains of collagen type VI in nuchal skin of human trisomy 21 fetuses. PMID:17602442
Results describe the characteristic features of myosclerosis myopathy with a homozygous collagen type 6A2 mutation responsible for a peculiar pattern of collagen VI defects. PMID:18852439