Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Signal Transduction
Alternative Names
CLDN3; C7orf1; CPETR2; Claudin-3; Clostridium perfringens enterotoxin receptor 2; CPE-R 2; CPE-receptor 2; Rat ventral prostate.1 protein homolog; hRVP1
Species
Homo sapiens (Human)
Expression Region
30-80aa
Target Protein Sequence
RVSAFIGSNIITSQNIWEGLWMNCVVQSTGQMQCKVYDSLLALPQDLQAAR
Note: The complete
sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is
translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application,
please explicitly request the full and complete sequence of this protein before ordering.
Tag Info
N-terminal 6xHis-B2M-tagged
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Images
-
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Description
This Recombinant Human Claudin-3 (CLDN3) is a specialized research reagent tailored for signal transduction investigations, providing a focused and cost-effective tool for dissecting the functional roles of human CLDN3. Produced in E. coli, this partial protein spans amino acids 30–80 aa of the human CLDN3, with a molecular weight of about 20 kDa and an N-terminal 6xHis-B2M tag to streamline purification and downstream detection. A key advantage of this product is its high purity—greater than 90% as confirmed by discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel—ensuring experimental accuracy and minimizing non-specific background noise. The partial nature of the protein, targeting a specific functional domain, allows for more targeted experimental design, such as epitope mapping or antibody generation, while the dual-tag system simplifies purification workflows compared to many conventional recombinant proteins. This recombinant CLDN3 protein is optimized for human research, offering scientists a reliable, high-purity tool to advance their understanding of CLDN3-mediated signaling pathways with enhanced experimental control and cost-efficiency.
